Details of Antibody
Antibody General Information
Name | DXP-593 |
||||||||
---|---|---|---|---|---|---|---|---|---|
Alias | BGB-DXP593 | ||||||||
Type | Antibody [Ab] | ||||||||
Protein/Region | S; RBD | ||||||||
Origin | B-cells (SARS-CoV2 Human Patient/Vaccinee) | ||||||||
Binds To | SARS-CoV-1 SARS-CoV-2_WT Pangolin-GD (Source ) |
||||||||
Neutralizing Vs | SARS-CoV-2_WT+D614G Pangolin-GD (Source) |
||||||||
Not Neutralizing Vs | SARS-CoV-1 SARS-CoV-2_WT+XBB SARS-CoV-2_Omicron(BA.1) SARS-CoV-2_Omicron(BA.2) SARS-CoV-2_Omicron(BA.3) SARS-CoV-2_Omicron(BA.4) SARS-CoV-2_Omicron(BA.5) SARS-CoV-2_Omicron(BQ.1.1) RaTG13 (Source) |
||||||||
Binding Affinity and Neutralization
This table lists binding affinity and neutralization data of DXP-593.
The binding affinity constant (KD, in nM units) determined by SPR and BLI can be used to evaluate the binding affinity of antibodies. Specifically, for the measured value x, x < 10 indicates a higher binding affinity, 10 ≤ x < 1000 indicates a moderate binding affinity, x ≥ 1000 indicates a lower binding affinity or even no binding.
The IC50, measured in ug/ml units using virus neutralization and ELISA assays, can be used to assess the neutralization activity of antibodies. Specifically, for the measured value x, x < 1 indicates a stronger neutralization activity, 1 ≤ x < 10 indicates a weak neutralization activity, x ≥ 10 indicates little or no neutralization activity.
The binding affinity constant (KD, in nM units) determined by SPR and BLI can be used to evaluate the binding affinity of antibodies. Specifically, for the measured value x, x < 10 indicates a higher binding affinity, 10 ≤ x < 1000 indicates a moderate binding affinity, x ≥ 1000 indicates a lower binding affinity or even no binding.
The IC50, measured in ug/ml units using virus neutralization and ELISA assays, can be used to assess the neutralization activity of antibodies. Specifically, for the measured value x, x < 1 indicates a stronger neutralization activity, 1 ≤ x < 10 indicates a weak neutralization activity, x ≥ 10 indicates little or no neutralization activity.
Gene and Sequence
Heavy Chain Gene | V Gene | IGHV3-23 (Human) | |||||||
---|---|---|---|---|---|---|---|---|---|
J Gene | IGHJ4 (Human) | ||||||||
Light Chain Gene | V Gene | IGKV2-28 (Human) | |||||||
J Gene | IGKJ5 (Human) | ||||||||
VH or VHH | EVQLLESGGGVVQPGGSLRLSCAASGFAFTTYAMNWVRQAPGRGLEWVSAISDGGGSAYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTRGRGLYDYVWGSKDYWGQGTLVTVSS | ||||||||
VL | DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPGTFGQGTRLEIK | ||||||||
CDRH3 | AKTRGRGLYDYVWGSKDY | ||||||||
CDRL3 | MQALQTPGT |
Reference
Data Update
Date Added | Nov 7, 2023 | ||||||||
---|---|---|---|---|---|---|---|---|---|
Date Updated | Nov 7, 2023 | ||||||||
Update Description | Nov 7, 2023. First Added |