logo

Details of Antibody

Antibody General Information
Name COR-101    AB359
Alias STE90-C11,DZIF-10c
Type Antibody [Ab]
Protein/Region S; RBD
Origin Phage Display (Ab, human, immune - SARS-CoV2)
Binds To SARS-CoV-2_WT (Source
Neutralizing Vs SARS-CoV-2_WT (Source
Structures and Antigen Binding Sites
PDB ID
3D Structure
7B3O
Antigen Binding Sites
This table lists binding sites of antibody-antigen complexes structure.
Earthy yellow cells indicate the occurrence of therapeutic monoclonal antibody (mAb) resistance mutations at this site. The data can be found at Statistics page.
Light blue cells indicate the obseravtion of mutation at this site in SARS-CoV-2 variants. Mutation data is from RCoV19 database.
Dark blue border cells with light blue background indicate both mutation site and therapeutic monoclonal antibody (mAb) resistance mutations.
Red border cells indicate conserved site in HCoVs with conservation score > 0.7. Conservation scores can be found at Conservation page.
Binding Affinity and Neutralization
This table lists binding affinity and neutralization data of COR-101.
The binding affinity constant (KD, in nM units) determined by SPR and BLI can be used to evaluate the binding affinity of antibodies. Specifically, for the measured value x, x < 10 indicates a higher binding affinity, 10 ≤ x < 1000 indicates a moderate binding affinity, x ≥ 1000 indicates a lower binding affinity or even no binding.
The IC50, measured in ug/ml units using virus neutralization and ELISA assays, can be used to assess the neutralization activity of antibodies. Specifically, for the measured value x, x < 1 indicates a stronger neutralization activity, 1 ≤ x < 10 indicates a weak neutralization activity, x ≥ 10 indicates little or no neutralization activity.
Gene and Sequence
Heavy Chain Gene V Gene IGHV3-66 (Human)
J Gene IGHJ3 (Human)
Light Chain Gene V Gene IGKV1-9 (Human)
J Gene IGKJ3 (Human)
VH or VHH QVQLVESGGGLVQPGGSLRLSCAASGLTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCARDVADAFDIWGQGTMVTVSS
VL DIVMTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPPFTFGPGTKVDIK
CDRH3 ARDVADAFDI
CDRL3 QQLNSYPPFT
Reference
Ref 1 EP3919126A1 (https://patents.google.com/patent/EP3919126A1/en)
Ref 2 Federico Bertoglio et al., 2021 (https://www.nature.com/articles/s41467-021-21609-2)
Data Update
Date Added Oct, 2022
Date Updated Oct, 2022
Update Description Oct, 2022. First Added