Level	Patient ID	Tumor Type	Tumor Type detaile	Mutation Type	Gene	Mutation	Position	Mutant Peptide	HLA	Pubmed ID	Reference Name	Journal	Year
tier1	3713	Skin	Melanoma	SNV	SEC22C	SEC22C_H248Y	9	AEHSLQVAY	B44:03	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	MEL21	Skin	Melanoma	SNV	TKT	TKT_R438W	4	AMFWSVPTV	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	3784	Skin	Melanoma	SNV	KIF6B	KIF6B_L1020P	2	APARLERRHSAL	B07:02	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3733	Skin	Melanoma	SNV	ACSS3	ACSS3_H194Y	7	ARIGAIYSL	C07:02	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	NA	Colorectal	Colorectal Cancer	SNV	AP2S1	AP2S1_N86K	8	AYLEAIHKF	A24:02	PMID:33537174	Characterization of CD8+ T-cell responses to non-anchor-type HLA class I neoantigens with single amino-acid substitutions	Oncoimmunology	2021	https://doi.org/10.1080/2162402X.2020.1870062	dbPepNeo	1
tier1	NA	Breast	Breast Cancer	SNV	CAND1	CAND1_K370T	7	AYLSLLTQT	H2-Kd	PMID:33476307	Radiotherapy-exposed CD8+ and CD4+ neoantigens enhance tumor control	Journal of Clinical Investigation 	2021	https://doi.org/10.1172/JCI138740.	NA	0
tier1	MEL21	Skin	Melanoma	SNV	TMEM48	TMEM48_F169L	9	CLNEYHLFL	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	NA	Skin	Melanoma	SNV	MED15	MED15_P677S	4	DANSFLQSV	B51:01	PMID:26819371	Use of HLA peptidomics and whole exome sequencing to identify human immunogenic neo-antigens	Oncotarget	2016	https://doi.org/10.18632/Oncotarget.6960	dbPepNeo,NeoPeptide,NEPdb	3
tier1	3733	Skin	Melanoma	SNV	ANO10	ANO10_P175S 	4	EPRSGFHGVL	B07:02	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3795	Skin	Melanoma	SNV	RBBP6	RBBP6_R793C	4	ETECEYFNRY	A01:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3713	Skin	Melanoma	SNV	AFMID	AFMID_A87V	2	EVLPFFLFF	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	3713	Skin	Melanoma	SNV	PRDX3	PRDX2_P44L	4	FFYLLDFTF	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	3713	Skin	Melanoma	SNV	WDR46	WDR46_T227I	3	FLIYLDVSV	A02:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	dbPepNeo,NeoPeptide,NEPdb	3
tier1	MEL38	Skin	Melanoma	SNV	SEC24A	SEC24A_P469L	5	FLYNLLTRV	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	3703	Skin	Melanoma	SNV	MOV10	MOV10_D859N	7	GLDDIKNLKV	A02:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	NA	Skin	Melanoma	SNV	CSNK1A1	CSNK1A1_S27L	2	GLFGDIYLA	A02:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	CAPD,NEPdb,dbPepNeo	3
tier1	NA	Skin	Melanoma	SNV	SYTL4	SYTL4_S363F	6	GRIAFFLKY	B27:05	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier1	MEL218	Skin	Melanoma	SNV	MRPS5	MRPS5_P59L	2	HLYASLSRA	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	NA	NA	NA	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:33649166	Targeting a neoantigen derived from a common TP53 mutation	Science	2021	https://doi.org/10.1126/Science.abc8697	NA	0
tier1	MEL218	Skin	Melanoma	SNV	EXOC8	EXOC8_Q656P	7	IILVAVPHV	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	3795	Skin	Melanoma	SNV	NRAS	NRAS_Q61K	7	ILDTAGKEEY	A01:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3713	Skin	Melanoma	SNV	GCN1	GCN1_P769L	5	IMQTLAGELY	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	NA	Skin	Melanoma	SNV	MYO1B	MYO1B_E911K	1	KINKNPKYK	A03:01	PMID:10064075	A natural cytotoxic T cell response in a spontaneously regressing human Melanoma targets a neoantigen resulting from a somatic point mutation	European Journal of Immunology	1999	https://doi.org/10.1002/(sici)1521-4141(199902)29:02%3C592::aid-immu592%3E3.0.co;2-2	CAPD,NEPdb,dbPepNeo	3
tier1	NA	Skin	Melanoma	SNV	NCAPG2	NCAPG2_P333L	2	KLILWRGLK	A03:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier1	NA	Skin	Melanoma	SNV	AKAP6	AKAP6_M1482I	6	KLKLPIIMK	A03:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier1	MEL38	Skin	Melanoma	SNV	AKAP13	AKAP13_Q285K	8	KLMNIQQKL	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	MEL21	Skin	Melanoma	SNV	CDKN2A	CDKN2A_E153K	1	KMIGNHLWV	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	NA	Skin	Melanoma	SNV	MATN2	MATN2_E226K	1	KTLTSVFQK	A11:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	CAPD,dbPepNeo,NEPdb	3
tier1	MEL218	Skin	Melanoma	SNV	PABPC1	PABPC1_R520Q	5	MLGEQLFPL	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	MEL38	Skin	Melanoma	SNV	OR8B3	OR8B3_T190I	5	QLSCISTYV	A02:01	PMID:25837513	A dendritic cell vaccine increases the breadth and diversity of Melanoma neoantigen-specific T cells	Science	2015	https://doi.org/10.1126/Science.aaa3828	dbPepNeo,NeoPeptide	2
tier1	P03	Lung	Non Small Cell Lung Cancer	SNV	ACAD8	ACAD8_T105I	14	QTDVGGSGLSRLDISVIFEALATGCTS	A02:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier1	3713	Skin	Melanoma	SNV	HELZ2	HELZ2_D45N	3	QTNPVTLQY	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	3733	Skin	Melanoma	SNV	NYNRIN	NYNRIN_E1810K	8	RVADKASKK	A03:01 	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3713	Skin	Melanoma	SNV	PLSCR4	PLSCR4_R247C	3	RVCGPCSTY	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	3784	Skin	Melanoma	SNV	GNB5	GNB5_P377L	9	RVSTLRVSL	B07:02	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	dbPepNeo,NeoPeptide,NEPdb	3
tier1	P03	Lung	Non Small Cell Lung Cancer	SNV	PLCG1	PLCG1_M425L	14	SIEDHCSIAQQRNLAQYFKKVLGDTLL	A02:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier1	NA	Skin	Melanoma	SNV	NOP16	NOP16_P169L	9	SPGPVKLEL	B07:02	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier1	NA	Breast	Breast Cancer	SNV	ADGRF5	ADGRF5_V1129M	4	STPMFSMSSPISRRF	H2-IAd	PMID:33476307	Radiotherapy-exposed CD8+ and CD6+ neoantigens enhance tumor control	Journal of Clinical Investigation 	2021	https://doi.org/10.1172/JCI138740.	NA	0
tier1	3713	Skin	Melanoma	SNV	TPX2	TPX2_H458Y	9	TEDEHFEFY	B44:03	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	3733	Skin	Melanoma	SNV	PHIP1	PHIP1_E938G	9	TENGLTLEGW	B44:03	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	NA	Colorectal	Colorectal Cancer	SNV	RAD21	RAD21_D116E	8	TLPEEFHEF	A24:02	PMID:33537174	Characterization of CD8+ T-cell responses to non-anchor-type HLA class I neoantigens with single amino-acid substitutions	ONCOIMMUNOLOGY	2021	https://doi.org/10.1080/2162402X.2020.1870062	dbPepNeo	1
tier1	3713	Skin	Melanoma	SNV	SRPX	SRPX_P55L	2	TLWCSPIKV	A02:01	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	dbPepNeo,NeoPeptide,NEPdb	3
tier1	3713	Skin	Melanoma	SNV	SRPX	SRPX_P55L	2	TLWCSPIKV 	A02:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	3713	Skin	Melanoma	SNV	CENPL	CENPL_P79L	7	TLYSLTLLY	A29:02	PMID:27312342	Durable Complete Response from Metastatic Melanoma after Transfer of Autologous T Cells Recognizing 10 Mutated Tumor Antigens	Cancer Immunology Research	2016	https://doi.org/10.1158/2326-6066.CIR-15-0215	NEPdb,dbPepNeo	2
tier1	P03	Lung	Non Small Cell Lung Cancer	SNV	BCAR1	BCAR1_G23V	14	VLLSWKVLDFSGPVPQGTGQPCSCGHW	A02:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier1	Patient5	Colorectal	Colorectal Cancer	SNV	TP53	TP53_Y220C	4	VVPCEPPEV	A02:01	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide,dbPepNeo	2
tier1	3733	Skin	Melanoma	SNV	HYDIN	HYDIN_S1861F	2	YFLEFDQQY	C07:02 	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	NA	0
tier1	1	Brain	Glioblastoma	SNV	IDH1	IDH1_R132H	10	GWVKPIIIGH	B58:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	13	Brain	Glioblastoma	SNV	ATF7	ATF7_R131H	1	HPGSLPLHL	B53:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	2	Brain	Glioblastoma	SNV	SLC44A2	SLC44A2_L204M	4	ITDMVEGAKK	A03:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	15	Brain	Glioblastoma	SNV	RBKS	RBKS_T95A	7	KQNDISAEF	B15:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	MEL66	Skin	Melanoma	SNV	PORCN	PORCN_H346Y	8	LLHGFSFYL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier1	13	Brain	Glioblastoma	SNV	EPS15	EPS15_T217M	9	LVPPSKRKMWV	A68:02	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	14	Brain	Glioblastoma	SNV	PCDH19	PCDH19_A470T	6	NNTPGTYLLSV	A02:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	8	Brain	Glioblastoma	SNV	NUCB1	NUCB1_V300M	8	RLRMREHMMK	A03:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	MEL66	Ovary	Ovarian Cancer	SNV	AKAP9	AKAP9_L974F	5	RLSDFSEQL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier1	16	Brain	Glioblastoma	SNV	SLC9A6	SLC9A6_N572I	10	SAWLFRMWYI	A02:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	14	Brain	Glioblastoma	SNV	C14orf102	C14orf102_P979L	2	YLLAPLREAL	A02:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	7	Brain	Glioblastoma	SNV	RFX1	RFX1_T324M	2	YMQTASTSYY	A01:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	7	Brain	Glioblastoma	SNV	EPHB3	EPHB3_R677W	7	YTERQRWDF	A01:01	PMID:30733620	Actively personalized vaccination trial for newly diagnosed glioblastoma	Nature	2019	https://doi.org/10.1038/s41586-019-0959-z	dbPepNeo	1
tier1	NA	Skin	Leukaemia	RNA splicing	BCR/ABL	NA	NA	GVRGRVEEI	A2	PMID:17545610	Alternative BCR/ABL splice variants in philadelphia chromosome-positive leukemias result in novel tumor-specific fusion proteins that may represent potential targets for immunotherapy approaches.	Cancer?Research	2007	https://doi.org/10.1158/0008-5472.can-06-3737	NA	0
tier1	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	MLMAQEALAFL	A02:01	PMID:10399963	Interleukin-2-induced, melanoma-specific T cells recognize camel, an unexpected translation product of LAGE-1	International Journal of?Cancer	1999	https://doi.org/10.1002/(sici)1097-0215(19990730)82:3%3C442::aid-ijc19%3E3.0.co;2-z	NA	0
tier1	NA	Skin	Melanoma	RNA splicing	TRP-2	NA	NA	EVISCKLIKR	A68:01	PMID:9743519	Translation of a retained intron in tyrosinase-related protein (TRP) 2 mRNA generates a new cytotoxic T lymphocyte (CTL)-defined and shared human melanoma antigen not expressed in normal cells of the melanocytic lineage.?	Journal of Experimental Medicine	1998	https://doi.org/10.1084/jem.188.6.1005	NA	0
tier1	NA	Skin	Melanoma	RNA splicing	TRP-2	NA	NA	EVISCKLIKR	A33:01	PMID:9743519	Translation of a retained intron in tyrosinase-related protein (TRP) 2 mRNA generates a new cytotoxic T lymphocyte (CTL)-defined and shared human melanoma antigen not expressed in normal cells of the melanocytic lineage.?	Journal of Experimental Medicine	1998	https://doi.org/10.1084/jem.188.6.1005	NA	0
tier1	NA	Skin	Melanoma	INDEL	MART1	MART1_107_108insP	NA	APPAYEKLPSAEQF	DRB1*01:01	PMID:19581576	Identification of tumor-associated, MHC class II-restricted phosphopeptides as targets for immunotherapy.	Proceedings of the National Academy of Sciences	2009	https://doi.org/10.1073/pnas.0903852106	CAPD	1
tier1	NA	Breast	Breast Cancer	Fusion	MTSS1L,RPS15A	MTSS1L-RPS15A	NA	APKSSSGFSL	B07:02	PMID:31677477	The Landscape of Tumor Fusion Neoantigens: A Pan-Cancer Analysis	Science Translational Medicine	2019	https://doi.org/10.1016/j.isci.2019.10.028	dbPepNeo	1
tier1	NA	Breast	Breast Cancer	Fusion	OTUB1,CDC20	OTUB1-CDC20	NA	TAISPIAVLPR	A68:01	PMID:31677477	The Landscape of Tumor Fusion Neoantigens: A Pan-Cancer Analysis	Science Translational Medicine	2019	https://doi.org/10.1016/j.isci.2019.10.028	dbPepNeo	1
tier2	patient 16	Lung	Lung Cancer	SNV	SOX30	SOX30_S53L	9	AAASATLAL	C08:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Lung Cancer	SNV	Ndufs1	Ndufs1_V491A	1	AAVSNMVQKI	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	patient 7	Lung	Lung Cancer	SNV	E4F1	E4F1_G469A	6	ACAQCAKAFPKAYL	DRB1*12:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	CDK4	CDK4_R24C	2	ACDPHSGHFV	A02:01	PMID:7652577	A p16INK4a-insensitive CDK4 mutant targeted by cytolytic T lymphocytes in a human Melanoma	Science	1995	https://doi.org/10.1126/Science.7652577	NEPdb	1
tier2	P017	Skin	Melanoma	SNV	PGK1	PGK1_N204K	16	ADKIQLINNMLDKVKEMIIGGGMAFTFLKV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 2	Lung	Lung Cancer	SNV	SPATS2	SPATS2_R306L	10	AEAMEILLSL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 2	Lung	Lung Cancer	SNV	FBXW8	FBXW8_Q76L	10	AEFEVPKLVL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 1	Lung	Lung Cancer	SNV	SPEF2	SPEF2_D434Y	4	AEIFYQIVDL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Bladder	Bladder Cancer	SNV	LPGAT1	LPGAT1_D230N	5	AEPINIQTW	B44:03	PMID:9637538	An antigen recognized by autologous CTLs on a human bladder carcinoma	Journal of Immunology	1998	https://www.jimmunol.org/content/160/12/6188.long	NEPdb	1
tier2	4217	Colorectal	Colorectal Cancer	SNV	MUC4	MUC4_R4435S	6	AESWISKM	B49:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	patient 1	Lung	Lung Cancer	SNV	B4GALNT1	B4GALNT1_P333L	10	AETYARYRYL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	10	Lung	Non-Small-Cell Lung Cancer	SNV	SMO	SMO_H97Y	3	AEYQDMHSY	B44:02	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	CGLU116	Lung	Lung Cancer	SNV	PGAP1	PGAP1_Y903F	8	AFGSAHLFR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-small Cell Lung Cancer	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828	NEPdb,dbPepNeo	2
tier2	P004	Lung	Lung Cancer	SNV	BDKRB1	BDKRB1_G316C	16	AFTNSSLNPVIYVFVCRLFRTKVWELYKQCTKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P04-FLNA-P369L	Skin	Melanoma	SNV	FLNA	FLNA_P369L	9	AGQHIAKSLF	B44:02	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	P012	Breast	Breast Cancer	SNV	DDX60	DDX60_D1502E	15	AHLFGRRYFPPKFQEAHFEFYQSKVFLDDL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	12	Skin	Melanoma	SNV	BAZ2B	BAZ2B_G126E	6	AHTRTEATFFPPLLGI	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	3	Skin	Melanoma	SNV	BBS12	BBS12_Y583N	3	AINRPTVLK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	ARMC2	ARMC2_N351Y	16	AKIILALKVSRKNLLYVCKLIFKISRNEKND	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	CSNK1G2	CSNK1G2_G239D	3	ALDHMFMYFL	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	Patient1	Skin	Melanoma	SNV	CDK4	CDK4_R71L	2	ALDPHSGHFV	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	WHIM37	Breast	Breast Cancer	SNV	ZDHHC16	ZDHHC16_H288L	9	ALGALTVWL	A02:01	PMID:28619968	Breast Cancer Neoantigens Can Induce CD8+T-Cell Responses and Antitumor Immunity	Cancer Immunology Research	2017	https://doi.org/10.1158/2326-6066.CIR-16-0264	dbPepNeo	1
tier2	P017	Skin	Melanoma	SNV	HPS1	HPS1_V681A	13	ALHLSVIPTDLLAQQAGQLARRLWEASR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3466	Skin	Melanoma	SNV	ERBB2	ERBB2_H197Y	8	ALIHHNTYL	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide,NEPdb	3
tier2	Patient1	Skin	Melanoma	SNV	GCN1	GCN1_L2330P	6	ALLETPSLLL	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	2	Skin	Melanoma	SNV	G6PD	G6PD_A149V	9	ALPPTVYEV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	Patient 1	Skin	Melanoma	SNV	MLL2	MLL2_L14228H	8	ALSPVIPHI	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	12	Lung	Non-Small-Cell Lung Cancer	SNV	SERPINE1	SERPINE1_G196S	6	ALYFNSQWK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	3879	Skin	Melanoma	SNV	GANAB	GANAB_S184F	5	ALYGFVPVL	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide,NEPdb	3
tier2	2	Skin	Melanoma	SNV	POLQ	POLQ_S1719F	8	ANHDETSFLLPRKES	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	3	Skin	Melanoma	SNV	CRY1	CRY1_S71F	8	ANLRKLNFRLFVIRG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NCI-3784	Skin	Melanoma	SNV	KIF16B	KIF16B_L1009P	2	APARLERRHSA	B07:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NA	Lung	Lung Cancer	SNV	Chd2	Chd2_T647A	1	APLQNSLKEL	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	NA	Neuroblastoma	Neuroblastoma	SNV	ALK	ALK_R1275Q	2	AQDIYRASY	B15:01	PMID:29441070	A Recurrent Mutation in Anaplastic Lymphoma Kinase with Distinct Neoepitope Conformations	Frontiers in Immunology 	2018	https://doi.org/10.3389/fimmu.2018.00099	dbPepNeo	1
tier2	NA	Neuroblastoma	Neuroblastoma	SNV	ALK	ALK_R1275Q	2	AQDIYRASYY	B15:01	PMID:29441070	A Recurrent Mutation in Anaplastic Lymphoma Kinase with Distinct Neoepitope Conformations	Frontiers in Immunology 	2018	https://doi.org/10.3389/fimmu.2018.00099	dbPepNeo	1
tier2	P005	Biliary	Biliary Tract Cancer	SNV	KIAA1191	KIAA1191_R176H	11	AQKPSPLELIHAQANRMAEDPAALKP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	TSEN54	TSEN54_R472Q	2	AQMCISGF	C12:03	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	B1203	Lung	Non Small Cell Lung Cancer	SNV	NFYC	NFYC_Q241K	6	AQQITKTEV	B52:01	PMID:16287085	A point mutation in the NFYC gene generates an antigenic peptide recognized by autologous cytolytic T lymphocytes on a human squamous cell lung carcinoma	International Journal of Cancer	2006	https://doi.org/10.1002/ijc.21594	NEPdb,dbPepNeo	2
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALAR	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALARAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALARALKE	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALARALKEGR	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALARALKEGRIR	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	13	ARGGLVDEKALARALKEGRIRGA	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	P022	Colorectal	Colorectal Cancer	SNV	BUD13	BUD13_D183Y	16	ARHDSDTSPPRRIRHYSSDTSPPRRARH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4284	Colorectal	Colorectal Cancer	SNV	CYP2E1	CYP2E1_L101F	5	ARMEFFLLL	B37:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 16	Lung	Lung Cancer	SNV	CHPF	CHPF_D114V	4	ARPVEWLGRCILDA	DRB1*12:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	6	Skin	Melanoma	SNV	FAM50B	FAM50B_E78K	4	ARQKALVRERERQLA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	WDFY1	WDFY1_E44K	3	ASKDRTIRV	C07:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	HERC1	HERC1_P3278S	5	ASNASSAAK	A11:01	PMID:25765070	Mutational landscape determines sensitivity to PD-1 blockade in Non-Small Cell Lung Cancer	Science	2015	https://doi.org/10.1126/Science.aaa1348	dbPepNeo,NEPdb	2
tier2	5	Skin	Melanoma	SNV	PDIA6	PDIA6_P290S	10	ASRYGIRGFSTIKIF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Breast	Breast Cancer	SNV	Plekho1	Plekho1_P251S	2	ASYTPQAL	H2-Kb	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	4	Skin	Melanoma	SNV	ENTPD4	ENTPD4_P85L	7	ATDTNNLNVNY	A01:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	9	Skin	Melanoma	SNV	ENTPD4	ENTPD4_P85L	7	ATDTNNLNVNY	A11:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	3	Skin	Melanoma	SNV	CYFIP2	CYFIP2_E446K	10	ATRYNYTSEK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 16	Lung	Lung Cancer	SNV	NR4A1	NR4A1_F101K	9	ATSPASASK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3	Skin	Melanoma	SNV	AIMP1	AIMP1_F317Y	8	ATYKGVPYEVK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4	Skin	Melanoma	SNV	RPTOR	RPTOR_S755F	5	AVAFFPGNLSTSSSA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient 2	Skin	Melanoma	SNV	PGM5	PGM5_H469Y	5	AVGSYVYSV	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	P015	Biliary	Biliary Tract Cancer	SNV	CDCA5	CDCA5_F85L	14	AVQSPRRSPRISFLLEKENEPPGRE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	EVA1A	EVA1A_T91A	1	AVSDLSVRRHR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	NA	Lung	Lung Cancer	SNV	Arhgef10	Arhgef10_M207I	3	AWIENPEEAI	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	patient 2	Lung	Lung Cancer	SNV	SLC15A2	SLC15A2_V618F	10	AWQLPQYALF	A24:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NCI-3903	Skin	Melanoma	SNV	KIF1BP	KIF1BP_P246S	4	AYHSIEWAI	A24:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	patient 7	Lung	Lung Cancer	SNV	E4F1	E4F1_G469A	2	CAKAFPKAY	B15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	E4F1	E4F1_G469A	5	CAQCAKAFPK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	CSAG3	CSAG3_L37H	4	CEFHACWPAFTVLGE	DRB1*01:01	PMID:16888034	Spontaneous CD4+ T cell responses against TRAG-3 in patients with Melanoma and breast cancers.	Journal of Immunology	2006	https://doi.org/10.4049/jimmunol.177.4.2717	CAPD	1
tier2	NA	Skin	Melanoma	SNV	CSAG3	CSAG3_L37H	4	CEFHACWPAFTVLGE	DRB1*04:01	PMID:16888034	Spontaneous CD4+ T cell responses against TRAG-3 in patients with Melanoma and breast cancers.	Journal of Immunology	2006	https://doi.org/10.4049/jimmunol.177.4.2717	CAPD	1
tier2	NA	Skin	Melanoma	SNV	CSAG3	CSAG3_L37H	4	CEFHACWPAFTVLGE	DRB1*07:01	PMID:16888034	Spontaneous CD4+ T cell responses against TRAG-3 in patients with Melanoma and breast cancers.	Journal of Immunology	2006	https://doi.org/10.4049/jimmunol.177.4.2717	CAPD	1
tier2	P010	Colorectal	Colorectal Cancer	SNV	MEGF8	MEGF8_C923S	16	CFLFAAYLARYPHGGSRGWD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	RCHY1	RCHY1_E114K	10	CGICRIGPKKDFFHCLK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P019	Stomach	Gastric Carcinoma	SNV	ZNF48	ZNF48_R679S	16	CGKGFRRSSDLVKHHSVHTGEKPY	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	mice	B cell	Lymphoma	SNV	KRAS	KRAS_G12C	1	CGVGKSALT	NA	PMID:33298945	A nanoparticle vaccine that targets neoantigen peptides to lymphoid tissues elicits robust antitumor T cell responses	NPJ Vaccines	2020	https://doi.org/10.1038/s41541-020-00253-9	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	CLK3	CLK3_E276K	9	CHALRFLHKNQLTHT	DRB1*14:54	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	CDK12	CDK12_E928K	5	CILGKLFTK	A11:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	CAPD,dbPepNeo,NEPdb	3
tier2	NA	Skin	Melanoma	SNV	CDK12	CDK12_E928K	5	CILGKLFTKK	A11:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	P002	Ovary	Ovarian Cancer	SNV	CCDC176	CCDC176_D89G	15	CKMEKDIMSVLSYLNKQDQEKDNM	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4262	Stomach	Stomach Cancer	SNV	HNRNPU	HNRNPU_F580I	6	CLFAGIQRK	A03:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	ZNF138	ZNF138_A111V	8	CLQKHLEVR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_R248L	7	CMGGMNLR	A31:01	PMID:26752676	Identification of Individual Cancer-Specific Somatic Mutations for Neoantigen-Based Immunotherapy of Lung Cancer	Journal of Thoracic Oncology	2016	https://doi.org/10.1016/j.jtho.2015.11.006	dbPepNeo,NeoPeptide	2
tier2	patient 4	Lung	Lung Cancer	SNV	EPHB4	EPHB4_R312L	9	CRVGYFRAL	B39:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P001	Skin	Melanoma	SNV	KLK6	KLK6_I140T	10	CSANTTSCHTLGWGKTADG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 16	Lung	Lung Cancer	SNV	GUCD1	GUCD1_E177K	9	CSTSISNFK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	FAAP100	FAAP100_G53V	7	CSVSPSVSR	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	GTB16	Neuroendocrine	Neuroendocrine Tumor	SNV	TBC1D22A	TBC1D22A_R437S	4	CTISLWDTY	A01:01	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	NCI-3784	Skin	Melanoma	SNV	FLNA	FLNA_R2049C	1	CVRVSGQGL	B07:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide,NEPdb	3
tier2	patient 16	Lung	Lung Cancer	SNV	CALCRL	CALCRL_S286F	5	CWISFDTHLLY	DRB1*12:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	HSDL1	HSDL1_L25V	6	CYMEAVAL	C14:03	PMID:28405493	A library-based screening method identifies neoantigen-reactive T cells in peripheral blood prior to relapse of ovarian cancer	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2017.1371895	NeoPeptide,NEPdb	2
tier2	NA	Ovary	Ovarian Cancer	SNV	HSDL1	HSDL1_L25V	6	CYMEAVALV	C14:03	PMID:24323902	Surveillance of the tumor mutanome by T cells during progression from primary to recurrent ovarian cancer	Clinical Cancer Research	2014	https://doi.org/10.1158/1078-0432.CCR-13-2147	dbPepNeo,NeoPeptide	2
tier2	P012	Breast	Breast Cancer	SNV	BMPR1B	BMPR1B_L74V	15	DDSGLPVVTSGCLGVEGSDFQCRKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	7	DEKALARALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	NA	Skin	Melanoma	SNV	MGAT1	MGAT1_E220Q	4	DFFQYFRATYPLLKAD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	RUSC2	RUSC2_S569F	2	DFSQEFSPIQEAQQD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	6	Skin	Melanoma	SNV	DCUN1D4	DCUN1D4_E325K	10	DGAWPVLLDKFVEWYK	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	SS18	SS18_S281L	12	DGHNDYGYQQPLYPEQGYDRPY	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	SNV	TNR	TNR_R1007W	8	DGVSEEFWLVDLLPS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	PCSK9	PCSK9_V202F	11	DHREIEGRVMF	B18:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	P007	Lung	Lung Cancer	SNV	HUWE1	HUWE1_F267C	16	DKQMLLFTHIRLAHGCSNHRKRLQAVQARLH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	SNV	MGA	MGA_N2653D	10	DLFMMPRIVDVTSLA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	6	Skin	Melanoma	SNV	FAM50B	FAM50B_E78K	7	DMKARQKALV	B08:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	5	Skin	Melanoma	SNV	FAM200A	FAM200A_S116F	5	DNTIFRRICTIAKHLE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4136	Breast	Breast Cancer	SNV	SLC3A2	SLC3A2_K94T	8	DPPALASTNAEVT	DRB1*07:01	PMID:29867227	Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer	Nature Method	2018	https://doi.org/10.1038/s41591-018-0040-8	NEPdb,dbPepNeo	2
tier2	NA	Lung	Lung Cancer	SNV	Ppat	Ppat_I208M	10	DPYGNRPLCM	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	3	Skin	Melanoma	SNV	KCNC3	KCNC3_P715L	12	DRASFLLTDYALSPD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P006	Colorectal	Colorectal Cancer	SNV	PIWIL1	PIWIL1_A681V	16	DRGQELVDGLKVCLQVALRAWNSCNEYMPSR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	ACPP	ACPP_E34K	8	DRSVLAKKLKFVTLV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	UBA3	UBA3_N108K	7	DTIDVSKLNR	A68:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	9	DVFPQGLPNEYAFVT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	MRPL37	MRPL37_N275S	4	DVKSDTGF	A26:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	CGLU161	Lung	Non-Small-Cell Lung Cancer	SNV	KIAA1109	KIAA1109_R5393Q	7	DVRKKLQRSSM	A26:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	NA	Skin	Melanoma	SNV	MUM3	MUM3_S324F	3	EAFIQPITR	A68012	PMID:10820291	High frequency of autologous anti-Melanoma CTL directed against an antigen generated by a point mutation in a new helicase gene.	Journal of Immunology	2000	https://doi.org/10.4049/jimmunol.164.11.6057	CAPD	1
tier2	NA	Skin	Melanoma	SNV	BAZ2B	BAZ2B_G143E	1	EATFFPPLLGIPPLFA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	2069	Skin	Melanoma	SNV	BRAF	BRAF_V600E	15	EDLTVKIGDFGLATEKSRWSGSHQFEQLS	DRB1*04:04	PMID:14996715	CD4 (+) T cell recognition of mutated BRAF in Melanoma patients harboring the V599E mutation	Cancer Research	2004	https://doi.org/10.1158/0008-5472.can-03-3231.	NEPdb,dbPepNeo	2
tier2	4110	Bile buct	Bile Duct Cancer	SNV	TES	TES_K62N	5	EEDRNVGKLF	B44:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4	Skin	Melanoma	SNV	TNR	TNR_R1007W	4	EEFWLVDLLPSTHYT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	PWWP3A	PWWP3A_S51I	5	EEKLIVVLF	B44:02	PMID:29217585	Patient HLA class I genotype influences cancer response to checkpoint blockade immunotherapy	Science	2018	https://doi.org/10.1126/Science.aao4572	NA	0
tier2	4268	Colorectal	Colorectal Cancer	SNV	USP37	USP37_D100Y	8	EEMRLFLY	B18:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 1	Lung	Lung Cancer	SNV	MARCHF6	MARCHF6_Q583L	9	EENENSANL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	B cell	Lymphoma	SNV	EZH2	EZH2_Y641N	6	EFISENCGEII	DRB1*13:02	PMID:28811957	Mapping the human T cell repertoire to recurrent driver mutations in MYD88 and EZH2 in Lymphoma	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2017.1321184	NeoPeptide	1
tier2	P02	Lung	Non Small Cell Lung Cancer	SNV	OPLAH	OPLAH_G890D	14	EGAVFLSFKLVQGDVFQEEAVTEALRA	DQA1*05:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	WDR64	WDR64_E548K	9	EGKDWKEDKHCLRRLIFLKAQEKH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4069	Pancreas	Pancreatic Cancer	SNV	ZFYVE27	ZFYVE27_R6H	2	EHEGSGPEL	B38:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NCI-3903	Skin	Melanoma	SNV	KIF1BP	KIF1BP_P246S	7	EHNAYHSIEWA	B38:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	MIA3	MIA3_D646Y	10	EIDLPRELEY	A01:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	1	Skin	Melanoma	SNV	RPF1	RPF1_K182E	1	EIIPQCIAR	A68:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	BRCA2	BRCA2_I2840V	9	EKTSSGLYVFR	A31:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P018	Parotid	Parotid Carcinoma	SNV	PBX1	PBX1_N50K	15	ELAKKCGITVSQVSKWFGNKRIRYKKNIG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3971	Colorectal	Colorectal Cancer	SNV	CASP8	CASP8_F67V	4	ELLVRINRL	B08:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	Patient2	Skin	Melanoma	SNV	PARG	PARG_Y427N	7	ELMRDINSM	B35:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NA	0
tier2	6	Skin	Melanoma	SNV	ATP5J2-PTCD1	ATP5J2-PTCD1_R57Q	9	EMDFVRLAQLFARAR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4007	Colorectal	Colorectal Cancer	SNV	SKIV2L	SKIV2L_R653H	6	EMLFSHGLVK	A03:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NEPdb	2
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	SLC2A2	SLC2A2_E286A	12	EMRKEREEASSAQKVSIIQLFTNSSYR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	ABCC1	ABCC1_P1094S	8	ENQKAYYSSIVANRWL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P013	Skin	Melanoma	SNV	OGFR	OGFR_S557T	5	EPAETPSETPGPRPKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4213	Colorectal	Colorectal Cancer	SNV	SMAD5	SMAD5_P268delinsPKH	3	EPKHKHWCSI	B08:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P001	Skin	Melanoma	SNV	CYP4F2	CYP4F2_G511R	15	EPRRKPELVLRAEGRLWLRVEPLS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	SNV	TCHH	TCHH_D576E	7	EQEERREQLLKREEERRQQRL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 2	Lung	Lung Cancer	SNV	CCDC69	CCDC69_R89T	9	ERELELRDTL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3	Skin	Melanoma	SNV	CASP1	CASP1_P172S	11	ERFWRNILLLSLHKG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4	Skin	Melanoma	SNV	RPTOR	RPTOR_S755F	9	ESGGAVAFFPGNLST	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P020	Colorectal	Colorectal Cancer	SNV	GNAS	GNAS_R137W	11	ESKEPKEEKQWRRCKPKKPTRRDAS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4264	Esophageal	Esophageal Cancer	SNV	CCNYL1	CCNYL1_H84Y	7	ESNPSDYPR	A33:03	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	SETBP1	SETBP1_S503L	4	ESPLVGLETGGNAEKV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	2	Skin	Melanoma	SNV	POLQ	POLQ_S1719F	4	ETSFLLPRKESNIVD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Lung	Small Cell Lung Cancer	SNV	EEF2	EEF2_E586Q	6	ETVSEQSNV	A68:02	PMID:9823325	The peptide recognized by HLA-A68.2-restricted squamous cell carcinoma of the lung-specific cytotoxic T lymphocytes	Cancer Research	1998	https://cancerres.aacrjournals.org/content/58/22/5144.long	NEPdb	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	PIK3CA	PIK3CA_H1047R	11	EYFMKQMNDAR	A33:03	PMID:26752676	Identification of Individual Cancer-Specific Somatic Mutations for Neoantigen-Based Immunotherapy of Lung Cancer	Journal of Thoracic Oncology	2016	https://doi.org/10.1016/j.jtho.2015.11.006	dbPepNeo,NeoPeptide	2
tier2	NA	Skin	Melanoma	SNV	MMS22L	MMS22L_S437F	10	EYYSKNLNSF	A24:04	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo	1
tier2	L011	Lung	Non-Small Cell Lung Cancer	SNV	MTFR2	MTFR2_D283Y	6	FAFQEYDSF	B35:01	PMID:26940869	Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade	Science	2016	https://doi.org/10.1126/Science.aaf1490.	NEPdb,dbPepNeo	2
tier2	4	Skin	Melanoma	SNV	ARHGAP29	ARHGAP29_G670E	2	FEAEFTQVAKKEPDG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient11	Pancreas	Pancreatic Cancer	SNV	TP53	TP53_R282W	13	FEVRVCACPGRDWRTEEENLRKKGE	Class II	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide	1
tier2	3942	Colorectal	Colorectal Cancer	SNV	NUP98	NUP98_A359D	3	FGDVGSTLF	C08:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 7	Lung	Lung Cancer	SNV	INPP5J	INPP5J_C120Y	6	FGHMLYFLNCHLP	DRB1*15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	LCP1	LCP1_A93V	16	FHGLKSTDVAKTFRKVINKKEGICAIGGTSE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non Small Cell Lung Cancer	SNV	ACTN4	ACTN4_K122N	5	FIASNGVKLV	A02:01	PMID:11358829	A point mutation in the alpha-actinin-4 gene generates an antigenic peptide recognized by autologous cytolytic	Cancer Research	2001	https://cancerres.aacrjournals.org/content/61/10/4078.long	NEPdb	1
tier2	NA	Lung	Non Small Cell Lung Cancer	SNV	ME1	ME1_A156G	8	FLDEFMEGV	A02:01	PMID:11325844	High frequency of cytolytic T lymphocytes directed against a tumor-specific mutated antigen detectable with HLA tetramers in the blood of a lung carcinoma patient	Cancer Research	2005	https://cancerres.aacrjournals.org/content/61/9/3718.long	NEPdb	1
tier2	1	Skin	Melanoma	SNV	ACE	ACE_S167F	1	FLDPDLTNI	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	NA	Skin	Melanoma	SNV	MART2	MART2_G529E	3	FLEGNEVGKTY	A1	PMID:11160356	Isolation of a new Melanoma antigen, MART-2, containing a mutated epitope recognized by autologous tumor-infiltrating T lymphocytes.	Journal of Immunology	2001	https://doi.org/10.4049/jimmunol.166.4.2871	CAPD	1
tier2	patient 15	Lung	Lung Cancer	SNV	ZFYVE27	ZFYVE27_R103L	9	FLGNVEFFL	A02:07	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	1	Skin	Melanoma	SNV	DYM	DYM_S434F	1	FLGSLLILV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P11-SPOP-N147I	Skin	Melanoma	SNV	SPOP	SPOP_N147I	7	FLLDEAIGL	A02:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	KCNC3	KCNC3_P715L	8	FLLTDYALSPDGSIR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	NLGN1	NLGN1_Y67C	4	FLNCDIMLGV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	ASPM	ASPM_Q2902R	7	FLSAKHRRQVYLQI	DRB1*11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P04-CDC37L1-P186L	Skin	Melanoma	SNV	CDC37L1	CDC37L1_P186L	6	FLSDHLYLV	A02:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	patient 12	Lung	Lung Cancer	SNV	MFSD6	MFSD6_G477V	11	FLYWHLEDLNV	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3713	Skin	Melanoma	SNV	AHNAK	AHNAK_S4460F	1	FMPDFDLHL	A02:01	PMID:33303615	Stem-like CD8 T cells mediate response of adoptive cell immunotherapy against human cancer	Science	2020	http://Science.Sciencemag.org/content/370/6522/1328	dbPepNeo,NeoPeptide,NEPdb	3
tier2	2	Skin	Melanoma	SNV	DDX3X	DDX3X_E388K	4	FPKKIQMLA	B56:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	7	FPQGLPNEY	B35:01	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	7	FPQGLPNEYAFVT	B35:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	patient 4	Lung	Lung Cancer	SNV	TENM2	TENM2_V2109M	9	FPRAKMYFM	B35:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	17	Ovary	Ovarian Cancer	SNV	CLEC10A	CLEC10A_V143F	1	FPVHSEMLL	B35:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	patient 12	Lung	Lung Cancer	SNV	ZMYM2	ZMYM2_H301L	9	FQNGESATL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3942	Colorectal	Colorectal Cancer	SNV	KARS	KARS_D356H	7	FRNEGIHL	B14:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 8	Lung	Lung Cancer	SNV	RHOA	RHOA_K162R	2	FRRFPCLSL	C07:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	TRAPPC1	TRAPPC1_R129G	4	FRSGLDSYV	C06:02	PMID:10582700	Two antigens recognized by autologous cytolytic T lymphocytes on a Melanoma result from a single point mutation	Cancer Research	1999	https://cancerres.aacrjournals.org/content/59/22/5785.long	NEPdb,dbPepNeo	2
tier2	patient 2	Lung	Lung Cancer	SNV	MAN2A1	MAN2A1_V744F	1	FSSLNSGQI	C15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	PCSK9	PCSK9_V202F	1	FTDFENVP	C05:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	MAP2K4	MAP2K4_I367T	2	FTLMYEERAV	A02:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	3	Skin	Melanoma	SNV	EXOSC10	EXOSC10_D488N	3	FTNESYLELY	A01:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4	Skin	Melanoma	SNV	IDH2	IDH2_R188W	5	FVADWAGTFKMVFTP	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	BAI2	BAI2_G817S	4	FVISAVLY	A26:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	4077	Bile buct	Bile Duct Cancer	SNV	HIST1H2BE	HIST1H2BE_E72V	7	FVNDIFVRI	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NCI-3998	Skin	Melanoma	SNV	PDS5A	PDS5A_Y1000F;H1007Y	1,8	FVVPYMIYLL	C03:03	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NEPdb	2
tier2	NA	Skin	Melanoma	SNV	ARMT1	ARMT1_P286L	2	FYGKTILWF	A24:02	PMID:30880120	Identification of a neoantigen epitope in a Melanoma patient with good response to anti-PD-1 antibody therapy	Immunology Letters	2019	https://doi.org/10.1016/j.imlet.2019.02.004	NeoPeptide,dbPepNeo	2
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	MKRN3	MKRN3_K419M	3	FYMHEYPEGW	A24:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	KRAS	KRAS_G12A	3	GAAGVGKSAL	C03:04	PMID:26752676	Identification of Individual Cancer-Specific Somatic Mutations for Neoantigen-Based Immunotherapy of Lung Cancer	Journal of Thoracic Oncology	2016	https://doi.org/10.1016/j.jtho.2015.11.006	dbPepNeo,NeoPeptide	2
tier2	4095	Colorectal	Colorectal Cancer	SNV	KRAS	KRAS_G12D	3	GADGVGKSA	C08:02	PMID:27959684	T-Cell Transfer Therapy Targeting Mutant KRAS in Cancer	The New England Journal of Medicine	2016	https://doi.org/10.1056/NEJMoa1609279	NEPdb	1
tier2	3995	Colorectal	Colorectal Cancer	SNV	KRAS	KRAS_G12D	3	GADGVGKSAL	C05:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	3995	Colorectal	Colorectal Cancer	SNV	KRAS	KRAS_G12D	3	GADGVGKSAL	C08:02	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	6	Skin	Melanoma	SNV	CADM4	CADM4_V87fs	9	GAISASSTQKTPTTRL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	SCML4	SCML4_M196I	16	GCSASEKVQEKEEGRIESGG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P013	Skin	Melanoma	SNV	HSP90AB1	HSP90AB1_R719H	7	GDEDASHMEEVKKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P022	Colorectal	Colorectal Cancer	SNV	FOXO1	FOXO1_A353T	13	GDVHSMVYPPSATKMASTLPSLSEISNP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3678	Skin	Melanoma	SNV	RECQL5	RECQL5_P816L	11	GEEDGAGGHSL	B44:02	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NA	Skin	Melanoma	SNV	TPI1	TPI1_T65I	6	GELIGILNAAKVPAD	DRB1*01:01	PMID:10049939	Biochemical identification of a mutated human Melanoma antigen recognized by CD4(+) T cells	Journal of Experimental Medicine	1999	https://doi.org/10.1084/jem.189.5.757	CAPD	1
tier2	P001	Skin	Melanoma	SNV	RBMXL2	RBMXL2_A66T	17	GFAFVTFESPADAKAATRDMNGKSLD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	11	GGLVDEKALARALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	P010	Colorectal	Colorectal Cancer	SNV	ZNF829	ZNF829_A36	11	GGSRGQEIETSLANMETSLRSGQIPTK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4289	Kidney	Rectal Cancer	SNV	KRT37	KRT37_R114H	13	GHEKETMKFLNDHLANYLEKVRQLE	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	NA	Pancreas	Pancreatic Cancer	SNV	OR2A2	OR2A2_H52Y	7	GIICLDYKL	A02:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	P012	Breast	Breast Cancer	SNV	KNG1	KNG1_M339I	15	GIQYFNNNTQHSSLLTLNEVKRAQRQDTGE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	ADARB1	ADARB1_D340N	8	GKFGDLTNNFSSPHAR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	NUMA1	NUMA1_Q1713R	16	GKFQVATDALKSREPRAKPQLDLS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	CSNK1A1	CSNK1A1_S27L	2	GLFGDIYLAI	A02:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	NA	Skin	Melanoma	SNV	HERPUD1	HERPUD1_G161S	8	GLGPGFSSY	B15:01	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	3678	Skin	Melanoma	SNV	UGGT2	UGGT2_P882L	2	GLLDEDFYA	A02:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P019	Stomach	Gastric Carcinoma	SNV	MLXIP	MLXIP_C521Y	16	GLVITTHHPAPSAAPYGLALSPVTRPPQPR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	2	Skin	Melanoma	SNV	ABCB10	ABCB10_S405Y	3	GLYGNLIVL	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	BRCA2	BRCA2_I2840V	4	GLYVFRNER	A31:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	DDX60L	DDX60L_R1032H	3	GMHMGQLLK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4289	Kidney	Rectal Cancer	SNV	RAD21	RAD21_D162V	13	GNISILQENDFGVFGMDDREIMREG	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	IARS2	IARS2_T605P	2	GPSWSYVL	B42:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	3716	Skin	Melanoma	SNV	TFDP2	TFDP2_A270T	5	GQFLTPNSH	B15:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P005	Biliary	Biliary Tract Cancer	SNV	SPEG	SPEG_E480K	7	GRTEPGKGPQQEVRRRDQFPLT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	SNV	MDGA2	MDGA2_P28H	14	GSAACFSHSVADSHEVAFCQAKLPFLPPT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	SNV	MKNK1	MKNK1_P265S	8	GSAEYMASEVVEVFT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P02	Lung	Non Small Cell Lung Cancer	SNV	UPF3A	UPF3A_R380T	14	GSQDSGAPGEAMETLGRAQRCDDSPAP	A33:03	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	P012	Breast	Breast Cancer	SNV	TP53	TP53_K132M	16	GTAKSVTCTYSPALNMMFCQLAKTCPVQLWVKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	B4GAT1	B4GAT1_A259V	8	GTALVVPVFEIRRAR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	NACC1	NACC1_S405F	14	GTRHKVLLRRLLAFFFDRNTLANSCGT	B15	PMID:33298619	Mobilization of pre- existing polyclonal T cells specific to neoantigens but not self- antigens during treatment of a patient with Melanoma with bempegaldesleukin and nivolumab	Journal for Immunotherapy of Cancer	2020	http://dx.doi.org/10.1136/jitc-2020-001591	NA	0
tier2	P012	Breast	Breast Cancer	SNV	RAB3GAP1	RAB3GAP1_R629L	12	GTSAEGAHLRALMQSACLLSDMESFKA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	12	Skin	Melanoma	SNV	NCAPH2	NCAPH2_S181Y	3	GVYPMPGTQK	A03:01	PMID:30209080	Combined Analysis of Antigen Presentation and T-cell Recognition Reveals Restricted Immune Responses in Melanoma	Cancer Discovery	2018	https://doi.org/10.1158/2159-8290.CD-17-1418	NEPdb,dbPepNeo	2
tier2	P002	Ovary	Ovarian Cancer	SNV	CALHM1	CALHM1_P335T	10	GWAGGGPRPQRKEVATYFSKV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	CALHM1	CALHM1_S335T	10	GWAGGGPRPTRKEVATYFSKV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Brain	Glioma	SNV	IDH1	IDH1_R132H	10	GWVKPIIIGHHAYGDQYRAT	DRB1*01:01	PMID:25043048	A vaccine targeting mutant IDH1 induces antitumour Immunity	Nature	2014	https://doi.org/10.1038/Nature13387	NEPdb,dbPepNeo	2
tier2	4136	Breast	Breast Cancer	SNV	CATB	CTSB_D114H	13	GYNSYSVSNSEKHIM	DRB1*07:01	PMID:29867227	Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer	Nature Method	2018	https://doi.org/10.1038/s41591-018-0040-8	NEPdb,dbPepNeo	2
tier2	patient 15	Lung	Lung Cancer	SNV	TPM3	TPM3_L242I	3	HAINDMTSI	C02:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3	Skin	Melanoma	SNV	NOC3L	NOC3L_P702L	9	HALRRHYHL	B08:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	VPS13D	VPS13D_G1482R	10	HDFFESLHRRQAFHI	DRB1*11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P17-RETSAT-P546S	Skin	Melanoma	SNV	RETSAT	RETSAT_P546S	8	HDLGRLHSC	B37:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	P020	Colorectal	Colorectal Cancer	SNV	STXBP3	STXBP3_C159S	17	HESQVYTLDVPDAFYYSYSPDPGNAKGKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4289	Kidney	Rectal Cancer	SNV	OR52D1	OR52D1_A281V	13	HHEVPKHVHIFLVNLYVLVPPVLNP	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	TMEM120A	TMEM120A_G339R	10	HHKFHSQRHRSKK	DRB1*12:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	CGLU161	Lung	Non-Small-Cell Lung Cancer	SNV	OR52B4	OR52B4_Q25H	1	HHMWISIPF	B38:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	P018	Parotid	Parotid Carcinoma	SNV	BCLAF1	BCLAF1_N629S	16	HHVKEQYFKSAAMTLSERFTSYQKATEE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P04-FLNA-P369L	Skin	Melanoma	SNV	FLNA	FLNA_P369L	6	HIAKSLFEV	A02:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	4251	Stomach	Gastric Adenocarcinoma	SNV	RNF213	RNF213_P4766H	13	HIVEQKNGKERVHILWHFLQKEAEL	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	3	Skin	Melanoma	SNV	TMUB2	TMUB2_L118F	3	HLFDIQGLPK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	FADS2	FADS2_N364I	10	HLFPTMPRHI	A02:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	LAMB2	LAMB2_R1388W	6	HMANQWALGK	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	AU565	Breast	Breast Cancer	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	ESC3	Esophageal	Esophageal Adenocarcinoma	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	SKUT1	B cell	Leukemia	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	VMRCLCD	Lung	Lung Cancer	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	KMS26	Bone	Myeloma	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	SAOS	Osteosarcoma	Osteosarcoma	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	TYKNU	Ovary	Ovarian Cancer	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	KLE	Uterus	Uterine Carcinoma	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:30709841	Immunologic Recognition of a Shared p53 Mutated Neoantigen in a Patient with Metastatic Colorectal Cancer	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0686	NEPdb	1
tier2	4196	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R175H	8	HMTEVVRHC	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	KIF1BP	KIF1BP_P246S	6	HNAYHSIEWAI	B38:01	PMID:11120859	Efficient simultaneous presentation of NY-ESO-1/LAGE-1 primary and nonprimary open reading frame-derived CTL epitopes in Melanoma	Journal of immunology	2000	https://doi.org/10.4049/jimmunol.165.12.7253	dbPepNeo	1
tier2	4098	Ovary	Ovarian Cancer	SNV	RPTOR	RPTOR_D654G	13	HNVAMMLAQLVSGGS	DPA1*01:03/DPB1*10:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	4098	Ovary	Ovarian Cancer	SNV	RPTOR	RPTOR_D654G	13	HNVAMMLAQLVSGGS	DPA1*02:01/DPB1*10:01	PMID:29853601	T-cell responses to TP53 hotspot mutations and unique neoantigens expressed by human ovarian cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NEPdb,dbPepNeo	2
tier2	11	Skin	Melanoma	SNV	DMXL2	DMXL2_S239L	9	HPRAVTGFLWRKTSKY	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	5	HQKRPIPI	B15:03	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	5	HQKRPIPI	B40:13	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	5	HQKRPIPIKY	B15:01	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	3903	Skin	Melanoma	SNV	PHKA1	PHKA1_P34L	10	HQNPVTGLLL	B38:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P017	Skin	Melanoma	SNV	NGDN	NGDN_V247A	11	HRINYEESMMARLSVSKREKGRRKRA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P17-RETSAT-P546S	Skin	Melanoma	SNV	RETSAT	RETSAT_P546S	2	HSCVMASLR	A68:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	patient 7	Lung	Lung Cancer	SNV	QRICH2	QRICH2_R301H	4	HSIHPYTVF	B15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	D14	Skin	Melanoma	SNV	FMN2	FMN2_N851K	9	HSVSSAFKK	A03:01	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NA	0
tier2	4262	Colorectal	Colorectal Cancer	SNV	NAMPT	NAMPT_I178T	2	HTVTQFSSV	A69:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	9	HVKITDFGR	A33:03	PMID:26752676	Identification of Individual Cancer-Specific Somatic Mutations for Neoantigen-Based Immunotherapy of Lung Cancer	Journal of Thoracic Oncology	2016	https://doi.org/10.1016/j.jtho.2015.11.006	dbPepNeo,NeoPeptide	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	9	HVKITDFGR	A31:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	9	HVKITDFGRAK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	9	HVKITDFGRAKLLGAEE	DRB1*09:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	6	Skin	Melanoma	SNV	KRIT1	KRIT1_R600C	5	HWTNCILHEYKNLSTS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4127	Ovary	Ovarian Cancer	SNV	TP53	TP53_G245S	13	HYNYMCNSSCMGSMN	DRB3*02:02	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	PGAP1	PGAP1_Y903F	9	IAFGSAHLFR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	Patient 1	Medulloblastoma	Pediatric Medulloblastoma	SNV	PDCD10	PDCD10_A74P	4	IASPIKEL	C12:02	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	P006	Colorectal	Colorectal Cancer	SNV	TRAF3	TRAF3_K315R	16	IEIERQKEMLRNNESRILHLQRVIDSQAEKL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	STAB2	STAB2_G649R	15	IEITAKNGRIYTLTRVLIPPSIVPILPHRC	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	IFI27	IFI27_A110P	4	IGSPIAAVIAR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	patient 12	Lung	Lung Cancer	SNV	SIDT2	SIDT2_Y654	15	IHITLLLSTQLYY	DRB1*10:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4	Skin	Melanoma	SNV	ARHGAP29	ARHGAP29_G670E	5	IHLFEAEFTQVAKKE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P005	Biliary	Biliary Tract Cancer	SNV	PIGK	PIGK_S414C	16	IIHQKPKLKDWHPPGCFILGLWALI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	Patient 2	Skin	Melanoma	SNV	SLC38A1	SLC38A1_W454L	2	ILAALFLGL	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	KCNJ1	KCNJ1_T174M	16	ILAKISRPKKRAKTIMFSKNAVISKRGGKLC	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4032	Colorectal	Colorectal Cancer	SNV	PHLPP1	PHLPP1_G566E	4	ILCETCLIV	A02:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NA	Skin	Melanoma	SNV	CLPP	CLPP_P248L	9	ILDKVLVHL	A02:01	PMID:21216894	Antigen spreading contributes to MAGE vaccination-induced regression of Melanoma metastases.	Cancer Research	2011	http://cancerres.aacrjournals.org/lookup/doi/10.1158/0008-5472.CAN-10-2693	CAPD	1
tier2	2	Skin	Melanoma	SNV	NRAS	NRAS_Q61H	7	ILDTAGHEEY	A01:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	NA	Skin	Melanoma	SNV	NRAS	NRAS_Q61R	7	ILDTAGREEY	A01:01	PMID:11971032	A ras-mutated peptide targeted by CTL infiltrating a human Melanoma lesion.	Journal of Immunology	2002	https://doi.org/10.4049/jimmunol.168.9.4802	CAPD	1
tier2	3	Skin	Melanoma	SNV	EVL	EVL_S343F	3	ILFRTPSVAK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4	Skin	Melanoma	SNV	DHX40b	DHX40b_NeoORF	9	ILMHGLVSL	A02:01	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NeoPeptide	1
tier2	NA	Skin	Melanoma	SNV	HAUS3	HAUS3_T160A	7	ILNAMIAKI	A02:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	CAPD,dbPepNeo,NEPdb	3
tier2	3703	Skin	Melanoma	SNV	NSDHL	NSDHL_A290V	9	ILTGLNYEV	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P007	Lung	Lung Cancer	SNV	HIST1H2BE	HIST1H2BE_E18Q	16	IMNSFVNDIFERIAGQASRLAHYNKRSTIT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	MYO7A	MYO7A_D2093Y	10	INKYGVSLIY	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3775	Cervix	Cervical Carcinoma(Hpv+)	SNV	ALDH1A1	ALDH1A1_N150I	6	IPIDGIFFTY	B35:01	PMID:28408606	Landscape of immunogenic tumor antigens in successful immunotherapy of virally induced epithelial cancer	Science	2017	https://doi.org/10.1126/Science.aak9510	NEPdb,dbPepNeo	2
tier2	5	Skin	Melanoma	SNV	FAM200A	FAM200A_S116F	9	IPLSDNTIF	B35:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	5	Skin	Melanoma	SNV	FAM200A	FAM200A_S116F	9	IPLSDNTIFRRICTI	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	IDH1	IDH1_R132S	16	IPRLVSGWVKPIIIGSHAYGDQYRATD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	NA	NA	SNV	RICTOR	RICTOR_K1163I	7	IPYFQTINI	NA	PMID:33064988	A Phase Ib Trial of Personalized Neoantigen Therapy Plus Anti-PD-1 in Patients with Advanced Melanoma, Non-small Cell Lung Cancer, or Bladder Cancer	Cell	2020	https://doi.org/10.1016/j.cell.2020.08.053	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	SLC26A7	SLC26A7_R117Q	8	ISANAVEQIV	C15:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide,NEPdb,dbPepNeo	3
tier2	8	Skin	Melanoma	SNV	DHX33	DHX33_R13W	7	ISDSLLWKY	A11:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 16	Lung	Lung Cancer	SNV	CALCRL	CALCRL_S286F	3	ISFDTHLLY	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	EFCAB14	EFCAB14_E437K	10	ISLPGVSSTK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	6	ITDFGRAKL	C01:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Skin	Melanoma	SNV	GALC	GALC_P98L	11	ITLIGLPWSFLGWLGK	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4275	Colorectal	Colorectal Cancer	SNV	GPATCH8	GPATCH8_R954H	3	IYHSQSPHYF	A24:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	D14	Skin	Melanoma	SNV	DNMT1	DNMT1_S840C	6	IYKAPCENW	A24:02	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NA	0
tier2	P020	Colorectal	Colorectal Cancer	SNV	ERF	ERF_P346L	17	KAGGLAEGAGALAPPPLPPQIKVEPI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	5	KALARALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide,dbPepNeo	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	AQP12A	AQP12A_L28R	3	KARLPVGAY	A03:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P004	Lung	Lung Cancer	SNV	PTPRG	PTPRG_G271C	12	KASGDPYWAYSCAYGPEHWVTS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	2	Skin	Melanoma	SNV	BAZ2A	BAZ2A_S500F	7	KASPVTFPAAAFPTAS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	PRRC2C	PRRC2C_S2260F	6	KAWENFPNV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	5	Skin	Melanoma	SNV	OVGP1	OVGP1_P446S	9	KCENMTITSRGTTVT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	GUSB	GUSB_W100L	8	KDFNLLRLLGANAF	DRB1*11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	OS9	OS9_P446L	9	KELEGILLL	B44:03	PMID:29217585	Patient HLA class I genotype influences cancer response to checkpoint blockade immunotherapy	Science	2018	https://doi.org/10.1126/Science.aao4572	NeoPeptide	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	MAP2K4	MAP2K4_I367T	9	KELLKHPFTL	A02:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	4245	Colorectal	Colorectal Cancer	SNV	NBEAL2	NBEAL2_R371C	7	KEVFKECIGY	B15:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	P005	Biliary	Biliary Tract Cancer	SNV	RAB3IP	RAB3IP_L310P	16	KEVTHQGLSPLTLLIPVSSHH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 1	Lung	Lung Cancer	SNV	PMPCB	PMPCB_V392L	10	KEWMRLCTSL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P012	Breast	Breast Cancer	SNV	FAM47A	FAM47A_T308N	9	KFCPRPFENPLSHLR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4171	Colorectal	Colorectal Cancer	SNV	SIN3A	SIN3A_N520I	11	KFPELFNWFKIF	A24:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	FAM190A	FAM190A_V195A	6	KFSKPALQSQSISLV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Uterus	Uterine Leiomyosarcoma	SNV	MB21D2	MB21D2_W244G	3	KGGPAVAQSW	B58:01	PMID:28228279	Loss of PTEN is associated with resistance to anti-PD-1 checkpoint blockade therapy in metastatic uterine leiomyosarcoma	Immunity	2017	https://doi.org/10.1016/j.immuni.2017.02.001	NeoPeptide	1
tier2	P001	Skin	Melanoma	SNV	AHNAK	AHNAK_S5832T	17	KHGKLKFGTFGGLGSKTKGHYEVTGS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	SIRT2	SIRT2_P182L	8	KIFSEVTLK	A03:01	PMID:16247014	The response of autologous T cells to a human Melanoma is dominated by mutated neoantigens	Proceedings of the National Academy of Sciences	2005	https://doi.org/10.1073/pnas.0500090102	NEPdb	1
tier2	NA	Skin	Melanoma	SNV	EFTUD2	EFTUD2_E764K	10	KILDAVVAQK	A03:01	PMID:16247014	The response of autologous T cells to a human Melanoma is dominated by mutated neoantigens	Proceedings of the National Academy of Sciences	2005	https://doi.org/10.1073/pnas.0500090102	NEPdb	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	7	KITDFGRAK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	EGFR	EGFR_L591R	7	KITDFGRAKLL	DRB1*12:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	DST	DST_M6032V	16	KKADAELSWITETEKKLVSLGDIRLEQDQTS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P017	Skin	Melanoma	SNV	METTL12	METTL12_L64P	11	KKFFGYDEVQGLPLPLLQEAQAASPLRV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	SNV	LDOC1	LDOC1_K126R	16	KKKKKKKDSPILGDYRAFLDEMRQCFGWDDDED	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P010	Colorectal	Colorectal Cancer	SNV	RASGRF1	RASGRF1_Y1191C	16	KKKMYLTDLAFIEEGTPNCTEDGLVNFSKMRMIS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	SNV	MORF4L2	MORF4L2_R230K;E246Q	2,17	KKLFVRIGAMLAYTPLDQKSLALLLGYLHDFLK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P019	Stomach	Gastric Carcinoma	SNV	PPP6R3	PPP6R3_G1576S	15	KKNWSANFDVPMETTHSAPLDSVG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P004	Lung	Lung Cancer	SNV	IL20RB	IL20RB_D69Y	10	KKTEGPECDVTYDITATVPYNLRVRAT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P004	Lung	Lung Cancer	SNV	NLRP3	NLRP3_T438K;R454L	2,18	KKTTAVYVFFLSSLLQPLGGSQEHGL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	PRTG	PRTG_F1055L	5	KKWFLFQDSKKIQVE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient 1	Skin	Melanoma	SNV	SMARCD3	SMARCD3_H70Y	8	KLFEFLVYGV	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	1	Skin	Melanoma	SNV	ACPP	ACPP_E34K	1	KLKFVTLVF	B15:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	NeoPeptide,NEPdb	2
tier2	1	Skin	Melanoma	SNV	ACPP	ACPP_E34K	1	KLKFVTLVF	A24:02	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	16	Lung	Non-Small-Cell Lung Cancer	SNV	ZNF527	ZNF527_L260V	8	KLLSFHSV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	ADAM21	ADAM21_D95N	16	KLLVSRHLPVFTYTDNRALLEDQLFIPD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 12	Lung	Lung Cancer	SNV	LLGL2	LLGL2_K836M	3	KLMLKLTAL	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	3	Skin	Melanoma	SNV	CRY1	CRY1_S71F	4	KLNFRLFVIRGQPAD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4213	Colorectal	Colorectal Cancer	SNV	DDX1	DDX1_S281F	5	KLNLFQVRF	A32:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	STIM1	STIM1_N291S	7	KLRDEISLAK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	Patient 2	Skin	Melanoma	SNV	SNX24	SNX24_P132L	6	KLSHQLVLL	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	dbPepNeo,NEPdb	2
tier2	C003	Pancreas	Pancreatic Cancer	SNV	KRAS	KRAS_G12D	8	KLVVVGADGV	A02:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	A011	Pancreas	Pancreatic Cancer	SNV	KRAS	KRAS_G12V	8	KLVVVGAVGV	A02:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	NA	Ovary	Ovarian Cancer	SNV	KRAS	KRAS_G12V	8	KLVVVGAVGV	A02:01	PMID:33123756	Impact of tumor heterogeneity and microenvironment in identifying neoantigens in a patient with ovarian cancer	Cancer Immunology	2021	https://doi.org/10.1007/s00262-020-02764-9	NA	0
tier2	P004	Lung	Lung Cancer	SNV	TEK	TEK_M894I	15	KLWEIVSLGGTPYCGITCAELYEKLPQGYRL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	ATR	ATR_S296L	8	KLYEEPLLK	A03:01	PMID:24043743	Tumor exome analysis reveals neoantigen-specific T-cell reactivity in an ipilimumab-responsive Melanoma	Journal of Clinical Oncology	2013	https://doi.org/10.1200/JCO.2012.47.7521	dbPepNeo,NEPdb	2
tier2	Patient 1	Skin	Melanoma	SNV	ASTN1	ASTN1_P3803L	2	KLYGLDWAEL	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	4270	Pancreas	Pancreatic Cancer	SNV	MCAT	MCAT_Q121K	1	KPAIFVASL	B07:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	FAM190A	FAM190A_V195A	3	KPALQSQSISLVQQS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	ILDR2	ILDR2_R386H	17	KPDYWSGVMGGSSGASHGPSAMEYNKEDR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P04-DOPEY2-R365C	Skin	Melanoma	SNV	DOPEY2	DOPEY2_R365C	4	KPFCVLISL	B07:02	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	4007	Colorectal	Colorectal Cancer	SNV	H3F3B	H3F3B_A48T	11	KPHRYRPGTVTL	B07:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	Patient2	Skin	Melanoma	SNV	BRWD1	BRWD1_R925W	8	KPKKENLWRM	B07:02	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NA	0
tier2	P04-MLL3-P1028S	Skin	Melanoma	SNV	KMT2C	KMT2C_P1984S	3	KPSDTPRPVM	B07:02	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	4278	Colorectal	Colorectal Cancer	SNV	COPS2	COPS2_P308L	9	KPYTRIHIL	B14:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	CRLF3	CRLF3_L346V	8	KQDGYDSV	A02:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	patient 15	Lung	Lung Cancer	SNV	CDC7	CDC7_R59L	11	KRIHQFGIVHL	B27:05	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P001	Skin	Melanoma	SNV	MAGEC3	MAGEC3_S172R	10	KRLWGEKAGRLPESEPLFTYTLDEK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	BBX	BBX_E624K	1	KRSCKGALYK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	A004	Stomach	Gastric Cancer	SNV	CYP2A6	CYP2A6_N438Y	3	KRYCFGEGL	B14:02	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,dbPepNeo	2
tier2	A004	Stomach	Gastric Cancer	SNV	CYP2A6	CYP2A6_N438Y	3	KRYCFGEGL	C07:04	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,dbPepNeo	2
tier2	patient 7	Lung	Lung Cancer	SNV	SRPRA	SRPRA_T204A	3	KSAKSDAPK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	FAM172A	FAM172A_N100K	13	KSFIFMSEDALTKPQKLMVLIHGSG	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	2	Skin	Melanoma	SNV	PBRM1	PBRM1_K1072E	5	KSFKEIKLW	B57:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P001	Skin	Melanoma	SNV	FLNB	FLNB_P672S	16	KSGCIVNNLAEFTVDSKDAGKAPLK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P013	Skin	Melanoma	SNV	RBMX	RBMX_A78T	7	KSLDGKTIKVEQATKP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	VPS16	VPS16_S404F	8	KSLLRAAFFGKCFLDR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	5	Skin	Melanoma	SNV	GRIN2B	GRIN2B_E1104K	8	KSRREFDKIELAYRR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P019	Stomach	Gastric Carcinoma	SNV	TP53	TP53_F157L	15	KSVTCTYSPALNKMLCQLAKTCPVQLWVDS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	16	Lung	Non-Small-Cell Lung Cancer	SNV	COL5A2	COL5A2_P1266T	4	KTDTGVHATL	C05:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	ZNF506	ZNF506_A373T	2	KTFNWSSALNK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	NEU2	NEU2_L234T	9	KTGEQRVVTL	C12:03	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	MATN2	MATN2_E226K	1	KTLTSVFQKK	A11:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	KCNB1	KCNB1_P734R	3	KTRPRSPEK	A30:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_G105V	5	KTYQVSYGFR	A31:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	GTB16	Neuroendocrine	Neuroendocrine Tumor	SNV	ZNF611	ZNF611_D404G	4	KVCGTAFTW	A32:01	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	NCI-3998	Skin	Melanoma	SNV	MAGEA6	MAGEA6_E168K	1	KVDPIGHVY	A01:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	NCI-3998	Skin	Melanoma	SNV	MAGEA6	MAGEA6_E168K	1	KVDPIGHVYIF	C05:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NA	Breast	Breast Cancer	SNV	Pttg1	Pttg1_V53L	8	KVFNAPAL	H2-Kb	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	4251	Stomach	Gastric Adenocarcinoma	SNV	OR10H1	OR10H1_E297V	2	KVLKVAMKK	A03:01	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	dbPepNeo	1
tier2	P002	Ovary	Ovarian Cancer	SNV	SCML4	SCML4_M196I	10	KVQEKEEGRIESVVFVVALGF	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 12	Lung	Lung Cancer	SNV	SCAP	SCAP_V66F	10	KWGLALAAVF	A24:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P017	Skin	Melanoma	SNV	TPP2	TPP2_L1195S	11	KWTDLFDNKVSTFAYKHALVNKMYGR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TUBD1	TUBD1_V396A	9	KYEKSAVLASNSQFLVK	DRB1*16:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	CRC-010	Colorectal	Colorectal Cancer	SNV	AKT1	AKT1_E17K	1	KYIKTWRPRYF	A23:01	PMID:30841906	Persistent mutant oncogene specific T cells in two patients benefitting from anti-PD-1	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-018-0492-x	dbPepNeo	1
tier2	P013	Skin	Melanoma	SNV	NT5C3A	NT5C3A_D271G	13	KYMDSYDIVLVQGESLEVANSILQKILKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	INPP5J	INPP5J_C120Y	9	LAAFGHMLY	B15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	2	Skin	Melanoma	SNV	CDK13	CDK13_G857R	5	LADFRLARLYSSEESR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4097	Ovary	Ovarian Cancer	SNV	HIST1H1B	HIST1H1B_A71D	3	LADGGYDVEKNNSRI	DQA1*03:01:01/DQB1*04:02:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide	1
tier2	4097	Ovary	Ovarian Cancer	SNV	HIST1H1B	HIST1H1B_A71D	3	LADGGYDVEKNNSRI	DRB4*01:01	PMID:29853601	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NEPdb,dbPepNeo	2
tier2	1	Skin	Melanoma	SNV	ACPP	ACPP_E34K	4	LAKKLKFVTLVFRHGD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 8	Lung	Lung Cancer	SNV	ANKRD17	ANKRD17_P1871L	1	LANKPIAPNF	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	3	LARALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	4289	Kidney	Rectal Cancer	SNV	NRROS	NRROS_T254M	8	LATGGEAAFELEMLDLSHNQLLFFP	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	HSD17B1	HSD17B1_C167R	2	LBESLAVLLL	C07:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	patient 16	Lung	Lung Cancer	SNV	JAK1	JAK1_P429L	7	LCTDVALPLIVHNIQ	DRB1*12:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_Q331E	9	LDGEYFTLEIRGRERFE	DRB1*01:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	DHTKD1	DHTKD1_V643I	13	LEVSNSPLSEEAILGFEYGMSIESP	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	patient 2	Lung	Lung Cancer	SNV	ZNF300	ZNF300_V112F	5	LFRQFTFVNSKTVT	DRB1*15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Lung Cancer	SNV	Gsta2	Gsta2_Y9H	3	LHHFNARGRM	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NA	0
tier2	P018	Parotid	Parotid Carcinoma	SNV	CAND2	CAND2_R669G	NA	LHILASFLRKNQRALGLATLAALDALAQSQG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	PPP1R17	PPP1R17_E137G	16	LHMSPFAAGVTLLRDGRPKAIVEDDEK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	Patient 2	Skin	Melanoma	SNV	USP28	USP28_C986F	5	LIIPFIHLI	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	4271	Colorectal	Colorectal Cancer	SNV	WDFY1	WDFY1_E44K	13	LIPKEDGVITASKDRTIRVWLKRDS	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	NA	Breast	Breast Cancer	SNV	Pram1	Pram1_Q572L	1	LIRKAEKA	H2-Kd	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	P001	Skin	Melanoma	SNV	EIF2B3	EIF2B3_A123T	16	LITDVALHEVVDLFRTYDASLAMLMRKGQDS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	SLC35C2	SLC35C2_L359F	15	LKALHSRGDGGPKAFKGLGSSPDLELLLRS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	CHD2	CHD2_K1351R	13	LKKRKPRVKKENRVPRLKEEHGIEL	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	L012	Lung	Non Small Cell Lung Cancer	SNV	CHTF18	CHTF18_L351V	5	LLDIVAPK	A11:01	PMID:26940869	Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade	Science	2016	https://doi.org/10.1126/Science.aaf1490.	NEPdb,dbPepNeo	2
tier2	Patient 2	Skin	Melanoma	SNV	MRM1	MRM1_T56P	6	LLFGMPPCL	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	3	Skin	Melanoma	SNV	GTF3C2	GTF3C2_D811N	5	LLFQNTDLGSFHDLLR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_V272L	9	LLGRNSFELRVCACPGR	DRB1*09:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	3466	Skin	Melanoma	SNV	COL18A1	COL18A1_S306F	7	LLGVKLFGV	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	MAP2K4	MAP2K4_I367T	7	LLKHPFTLM	A30:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Skin	Melanoma	SNV	PRDX5	PRDX5_S79L	6	LLLDDLLVSI	A02:01	PMID:15695408	Immunogenicity without immunoselection: a mutant but functional antioxidant enzyme retained in a human metastatic Melanoma and targeted by CD8(+) T cells with a memory phenotype	Cancer Research	2005	https://cancerres.aacrjournals.org/content/65/2/632.long	NEPdb,dbPepNeo	2
tier2	NA	Pancreas	Pancreatic Cancer	SNV	KLRD1	KLRD1_S22L	2	LLLMSTLGI	A02:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	4032	Colorectal	Colorectal Cancer	SNV	API5	API5_R243Q	6	LLQCTQQAV	A02:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	GABBR2	GABBR2_C108R	16	LLRPYFLDLRLYDTERDNAKGLKAFYDAIKY	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P010	Colorectal	Colorectal Cancer	SNV	REL	REL_L331S	10	LLTSGDPPTSASQSAGITVKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	D05	Skin	Melanoma	SNV	TRRAP	TRRAP_F779L	6	LLYQELLPL	A02:01	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NeoPeptide	1
tier2	NCI-3998	Skin	Melanoma	SNV	MAGEA6	MAGEA6_E168K	3	LMKVDPIGHVY	B15:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	4	Skin	Melanoma	SNV	ARHGAP29	ARHGAP29_G670E	9	LPGKIHLFEAEFTQV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P020	Colorectal	Colorectal Cancer	SNV	BCL9L	BCL9L_P22L	13	LPHPRRREAPGSLPLSPRGHCPP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Breast	Breast Cancer	SNV	Aars2	Aars2_A697P	2	LPHTARIPG	H2-Ld	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	AHNAK2	AHNAK2_R3241H	16	LPKLQMPSFKMPKVDHKGPQIDI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	3	LPNEYAFVT	B35:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	NeoPeptide,NEPdb	2
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	3	LPNEYAFVTT	B35:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	NeoPeptide,NEPdb	2
tier2	NA	Pancreas	Pancreatic Cancer	SNV	POLRMT	POLRMT_T555A	8	LPRQYWEAL	B07:02	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	SLC39A14	SLC39A14_G72R	14	LQQLKALLNHLDVRVGRGNVTQHVQGH	A02	PMID:33298619	Mobilization of pre- existing polyclonal T cells specific to neoantigens but not self- antigens during treatment of a patient with Melanoma with bempegaldesleukin and nivolumab	Journal for Immunotherapy of Cancer	2020	http://dx.doi.org/10.1136/jitc-2020-001591	NA	0
tier2	4160	Colorectal	Colorectal Cancer	SNV	RNF43	RNF43_P119L	10	LQQPLGLTWL	C04:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	Patient 1	Medulloblastoma	Pediatric Medulloblastoma	SNV	PDCD10	PDCD10_A74P	10	LQTIKDIASPI	B52:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	VPS16	VPS16_S404F	5	LRAAFFGKCF	B27:05	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	12	Skin	Melanoma	SNV	CRELD2	CRELD2_P267fs	8	LRGLPGFVAAFVNIHL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 15	Lung	Lung Cancer	SNV	UBN2-2	UBN2_P520R	2	LRLHSFPTML	B27:05	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 15	Lung	Lung Cancer	SNV	UBN2	UBN2_P520R	2	LRLHSFPTMLK	A03:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P010	Colorectal	Colorectal Cancer	SNV	C4BPB	C4BPB_S9F	8	LRQSLALFPRLECSGTISAHCNLHL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	USH2A	USH2A_G4483A	5	LRRDATIVY	C07:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	D05	Skin	Melanoma	SNV	CCT6A	CCT6A_H161Y	6	LRTKVYAEL	B27:05	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NeoPeptide	1
tier2	P009	Pancreas	Pancreatic Carcinoma	SNV	CHPF2	CHPF2_E29G	16	LRTSLSLLRVSWIQGGGEDPCV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	KIF17	KIF17_V388A	16	LSALLSRQVPPDPVQAEEKLLPQPVIQH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	PCDH7	PCDH7_S974G	4	LSDGPSMGRY	A01:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	DHTKD1	DHTKD1_V643I	6	LSEEAILGFEY	A01:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 17	Lung	Lung Cancer	SNV	ACSL1	ACSL1_E140K	10	LSLVFVDKPKKAKLL	DRB1*08:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P017	Skin	Melanoma	SNV	PHKB	PHKB_Q909H	15	LSPSEVKQLLLDILHPQQNGRCWLNRRQID	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	IL22	IL22_A123S	2	LSRLSNRLL	B08:01	PMID:18157007	The TAG family of cancer/testis antigens is widely expressed in a variety of malignancies and gives rise to HLA-A2-restricted epitopes	Journal of Immunology	2008	https://doi.org/10.1097/CJI.0b013e318159f797	dbPepNeo	1
tier2	patient19	Skin	Melanoma	SNV	SLC16A4	SLC16A4_F245L	8	LSSVSFFLV	A11:01	PMID:28596308	Mismatch repair deficiency predicts response of solid tumors to PD-1 blockade	Science	2017	https://doi.org/10.1126/Science.aan6733	NEPdb	1
tier2	4241	Colorectal	Colorectal Cancer	SNV	MED14	MED14_Q226R	6	LSVWNRQVL	C03:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	PLEKHM2	PLEKHM2_H1005Y	10	LTDDRLFTCY	A01:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_T790M	9	LTSTVQLIM	C15:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_T790M	9	LTSTVQLIMQLMPFGCL	DRB1*09:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	9	LVDEKALARALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	patient 12	Lung	Lung Cancer	SNV	CYB5R3	CYB5R3_M256I	10	LVLMCGPPPI	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	1	Skin	Melanoma	SNV	ZBED4	ZBED4_S218F	11	LVQKVASKIPFPDRI	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	NDUFS8	NDUFS8_H24Q	15	LVRVGDHWEDALPDQAYAAAGPGPG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	KRAS	KRAS_G12V	7	LVVVGAVGV	A02:01	PMID:33123756	Impact of tumor heterogeneity and microenvironment in identifying neoantigens in a patient with ovarian cancer	Cancer Immunology	2021	https://doi.org/10.1007/s00262-020-02764-9	NA	0
tier2	NA	Colorectal	Gut Carcinoma	SNV	CEA	CEA_G538N	6	LWWVNNQSLPVSP	DR11	PMID:14679013	CD4(+) T cells from healthy subjects and colon cancer patients recognize a carcinoembryonic antigen-specific immunodominant epitope.	Cancer Research	2003	http://cancerres.aacrjournals.org/content/63/23/8481	CAPD	1
tier2	NA	Colorectal	Gut Carcinoma	SNV	CEA	CEA_G538N	6	LWWVNNQSLPVSP	DR13	PMID:14679013	CD4(+) T cells from healthy subjects and colon cancer patients recognize a carcinoembryonic antigen-specific immunodominant epitope.	Cancer Research	2003	http://cancerres.aacrjournals.org/content/63/23/8481	CAPD	1
tier2	NA	Colorectal	Gut Carcinoma	SNV	CEA	CEA_G538N	6	LWWVNNQSLPVSP	DR14	PMID:14679013	CD4(+) T cells from healthy subjects and colon cancer patients recognize a carcinoembryonic antigen-specific immunodominant epitope.	Cancer Research	2003	http://cancerres.aacrjournals.org/content/63/23/8481	CAPD	1
tier2	D14	Skin	Melanoma	SNV	MAGEA10	MAGEA10_D257N	3	LYNGMEHLI	A24:02	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	DPY19L4	DPY19L4_L143F	5	LYPEFIASI	A24:02	PMID:29541393	Effective screening of T cells recognizing neoantigens and construction of T-cell receptor-engineered T cells	Oncotarget	2018	https://doi.org/10.18632/Oncotarget.24232	dbPepNeo,NeoPeptide	2
tier2	8	Ovary	Ovarian Cancer	SNV	NAV1	NAV1_K349M	1	MAKAKAVAL	B35:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	P022	Colorectal	Colorectal Cancer	SNV	EMC2	EMC2_L7P	7	MAKVSEPYDVTWEEMRDKM	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_H773L;V774M	8,9	MASVDNPLMCRLLGICL	DRB1*09:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	CCDC176	CCDC176_D89G	16	MEKDIMSVLSYLKKQGQEKDNMIEKLKQQLN	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	GTB16	Neuroendocrine	Neuroendocrine Tumor	SNV	TRPC4AP	TRPC4AP_T63M	1	MERDKQSKW	B44:03	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	NA	Pancreas	Pancreatic Cancer	SNV	MUC16	MUC16_N1890K	3	MGKSTHTSM	B08:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	FN1	FN1_E2145K	5	MIFEKHGFRRTTPP	DRB1*15:01	PMID:12045238	Identification of a mutated fibronectin as a tumor antigen recognized by CD4+ T cells: its role in extracellular matrix formation and tumor metastasis	Journal of Experimental Medicine	2002	https://dx.doi.org/10.1084%2Fjem.20020141	CAPD	1
tier2	6	Skin	Melanoma	SNV	DNMT3A	DNMT3A_E865K	2	MKRVFGFPVHYTDVS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	SLC15A2	SLC15A2_I443M	1	MKSFQKTPHY	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	HERV-K-MEL	HERV-K-MEL_V102I	5	MLAVISCAV	A02:01	PMID:12359761	A human endogenous retroviral sequence encoding an antigen recognized on Melanoma by cytolytic T lymphocytes	Cancer Research	2002	https://cancerres.aacrjournals.org/content/62/19/5510.long	dbPepNeo	1
tier2	patient 4	Lung	Lung Cancer	SNV	CARD6	CARD6_R98L	10	MLCSDSSLQL	A02:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4007	Colorectal	Colorectal Cancer	SNV	SKIV2L	SKIV2L_R653H	5	MLFSHGLVK	A03:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NeoPeptide,NEPdb	3
tier2	patient 16	Lung	Lung Cancer	SNV	SLC12A4	SLC12A4_V126M	1	MLICCCCTL	A02:10	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	RNF19B	RNF19B_V372L	2	MLIGIPVYV	A02:01	PMID:29541393	Effective screening of T cells recognizing neoantigens and construction of T-cell receptor-engineered T cells	Oncotarget	2018	https://doi.org/10.18632/Oncotarget.24232	dbPepNeo,NeoPeptide	2
tier2	NA	Skin	Melanoma	SNV	TYR	TYR_L1M	1	MLLAVLYCL	A2	PMID:8125142	Two tyrosinase nonapeptides recognized on HLA-A2 Melanomas by autologous cytolytic T lymphocytes	European Journal of Immunology	1994	https://doi.org/10.1002/eji.1830240340	CAPD	1
tier2	Patient1	B cell	Chronic Lymphocytic Leukemia	SNV	C6ORF89	C6ORF89_Y318C	10	MPIEPGDIGC	B35:01	PMID:24891321	Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia	Blood	2014	https://doi.org/10.1182/blood-2014-04-567933	dbPepNeo	1
tier2	4136	Breast	Breast Cancer	SNV	ECPAS	ECPAS_S186F	10	MPYGYVLNEF	B35:01	PMID:29867227	Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer	Nature Method	2018	https://doi.org/10.1038/s41591-018-0040-8	NEPdb,dbPepNeo	2
tier2	P012	Breast	Breast Cancer	SNV	MMRN1	MMRN1_Q297K	11	MQKMTDQVNYKAMKLTLLQKKIDNIS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 8	Lung	Lung Cancer	SNV	EGFR	EGFR_T523M	1	MQLMPFGCL	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	patient 8	Lung	Lung Cancer	SNV	EGFR	EGFR_T523M	1	MQLMPFGCLL	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Non-Small Cell Lung Cancer	SNV	EGFR	EGFR_T790M/C797S	1,8	MQLMPFGSLL	A02:01	PMID:32391625	Efficacy of immunotherapy targeting the neoantigen derived from epidermal growth factor receptor T790M/C797S mutation in non small cell lung cancer	Cancer Science	2020	https://doi.org/10.1111/cas.14451	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	NDUFS8	NDUFS8_T6K	6	MRCLTKPMLLRALAQAARAGP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	EXO1	EXO1_C219S	2	MSILSGCDY	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P012	Breast	Breast Cancer	SNV	SHROOM1	SHROOM1_P180L	16	MSLPARLRPTVPARPLATHPRSASLSHPG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	CPOX	CPOX_E428K	10	MSLPLTARWK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Colorectal	Colorectal Cancer	SNV	KRAS	KRAS_G12D	12	MTEYKLVVVGAGGVGKSALTIQLI	 C08:02	PMID:27959684	T-Cell Transfer Therapy Targeting Mutant KRAS in Cancer	The New England Journal of Medicine	2016	https://doi.org/10.1056/NEJMoa1609279	dbPepNeo	1
tier2	1139	Lung	Non-Small-Cell Lung Cancer	SNV	KRAS	KRAS_G12V	12	MTEYKLVVVGAVGVGKSALTIQLIQ	DRB1*11:04	PMID:31043415	Endogenous CD4+ T Cells Recognize Neoantigens in Lung Cancer Patients, Including Recurrent Oncogenic KRAS and ERBB2 (Her2) Driver Mutations	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0402	NeoPeptide	1
tier2	5	Skin	Melanoma	SNV	OVGP1	OVGP1_P446S	5	MTITSRGTTVTPTKE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	SNV	NPIPB6	NPIPB6_P232L	16	MVAAEHRHSSGLPYWLYLTAETLKNRMGRQP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 15	Lung	Lung Cancer	SNV	UBN2-1	UBN2_P520R	6	MVKTLRLHSFPTMLKECSP	DRB1*04:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	A008	Pancreas	Pancreatic Cancer	SNV	DIS3L2	DIS3L2_I777V	5	MVMGVLKQAFDVLVL	DRB1*07:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,dbPepNeo	2
tier2	7	Brain	Glioblastoma	SNV	ARHGAP35	ARHGAP35_T1313M	1	MVNTVAGAMK	A68:01	PMID:30568305	Neoantigen vaccine generates intratumoral T cell responses in phase Ib glioblastoma trial	Nature	2019	https://doi.org/10.1038/s41586-018-0792-9	NeoPeptide,dbPepNeo	2
tier2	NCI-3903	Skin	Melanoma	SNV	KIF1BP	KIF1BP_P246S	5	NAYHSIEWAI	C12:03	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	patient 15	Lung	Lung Cancer	SNV	CTH	CTH_D175Y	4	NDRYVLGISDTLIRL	DRB1*04:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4246	Colorectal	Colorectal Cancer	SNV	MYO5B	MYO5B_K1410Q	7	NENLDLQEL	B40:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4149	Ovary	Ovarian Cancer	SNV	CTAGE5	CTAGE5_E576V	5	NERGVSSCDRLTDPH	DQA1*01:03:01/DQB1*06:03:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	P013	Skin	Melanoma	SNV	SIGLEC10	SIGLEC10_Q111K	16	NFMNDGFFLKVTALTKKPDVYI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4251	Stomach	Stomach Cancer	SNV	RNF213	RNF213_P4766H	7	NGKERVHIL	B08:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	GTF3C2	GTF3C2_D811N	9	NHHYLLFQNTDLGSF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	3942	Colorectal	Colorectal Cancer	SNV	GPD2	GPD2_E426K	8	NHVVDISKSGLITIA	DRB1*07:01	PMID:26516200	Immunogenicity of somatic mutations in human gastrointestinal cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	NEPdb,dbPepNeo	2
tier2	A017	Thymoma	Thymoma	SNV	CDC73	CDC73_Q254E	7	NIFAILESV	A02:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,dbPepNeo	2
tier2	patient 15	Lung	Lung Cancer	SNV	CTDSP2	CTDSP2_C44S	9	NIFKALFCSFRAQHV	DRB1*04:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	LUAD-3001	Lung	Non-Small Cell Lung Cancer	SNV	BRAF	BRAF_N581I	2	NIIFLHEDLTV	A02:01	PMID:30841906	Persistent mutant oncogene specific T cells in two patients benefitting from anti-PD-1	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-018-0492-x	dbPepNeo	1
tier2	patient 7	Lung	Lung Cancer	SNV	TBL3	TBL3_V52L	5	NILELASGAVLR	DRB1*12:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	CAPG	CAPG_A196V	14	NILERNKARDLALVIRDSERQGKAQVL	NA	PMID:33298619	Mobilization of pre- existing polyclonal T cells specific to neoantigens but not self- antigens during treatment of a patient with Melanoma with bempegaldesleukin and nivolumab	Journal for Immunotherapy of Cancer	2020	http://dx.doi.org/10.1136/jitc-2020-001591	NA	0
tier2	P017	Skin	Melanoma	SNV	BEND3	BEND3_R781C	14	NKKQLDPTRLRLICHYVEAVYPVEKMEEV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	24	Ovary	Ovarian Cancer	SNV	OR51B4	OR51B4_K183N	1	NLACADITF	B35:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	NA	Pancreas	Pancreatic Cancer	SNV	TP53	TP53_E280K	9	NLLGRNSFK	A68:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	Patient 1	Skin	Melanoma	SNV	GNL3L	GNL3L_R634C	4	NLNCCSVPV	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NEPdb	1
tier2	6	Skin	Melanoma	SNV	SMC4	SMC4_L1262F	9	NMFEISDRFIGIYKT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	PRTG	PRTG_F1055L	9	NNSKKKWFLFQDSKK	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4289	Kidney	Rectal Cancer	SNV	SPATA31D1	SPATA31D1_G1456fs		NPEVHVRAEPVQGLSLQLQGSLLQSDTYQILQPTSYLCWPELSYKD	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	12	Skin	Melanoma	SNV	B3GNT1	B3GNT1_A259V	12	NQWGGTALVVPVFEI	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P005	Biliary	Biliary Tract Cancer	SNV	KIF7	KIF7_R654S	13	NRISNCSQRAGASPGSLPERKGPE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4149	Ovary	Ovarian Cancer	SNV	TP53	TP53_Y220C	11	NTFRHSVVVPCEPPE	DRB3*02:02	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb,dbPepNeo	3
tier2	patient 2	Lung	Lung Cancer	SNV	TGM3	TGM3_D622Y	11	NVQMLFSNPLYEPV	DRB1*15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P006	Colorectal	Colorectal Cancer	SNV	SHANK1	SHANK1_G2071R	16	PAARRSLLHRLPPTAHGVGPLLLQLGTEPPA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	SNV	GRIN2B	GRIN2B_E1104K	12	PASAKSRREFDKIEL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	SENP3	SENP3_P37R	16	PAYSSPRRERLRWPPRPKPRLKSGGG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	SNV	MGA	MGA_N2653D	14	PENDDLFMMPRIVDV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	2	Skin	Melanoma	SNV	C14orf101	C14orf101_A59D	11	PGGDSGELITDAHEL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	2	Skin	Melanoma	SNV	DDX3X	DDX3X_E388K	3	PKKIQMLARDFLDEY	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	RUSC2	RUSC2_S569F	9	PLRVSVGDFSQEFSP	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P010	Colorectal	Colorectal Cancer	SNV	NFKBID	NFKBID_A37S	3	PPSSASQSAGITGVSHRT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	SNV	RIF1	RIF1_K793T	11	PQRPSDWSKKTNEPLGKLTSLFKLIV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	TBC1D14	TBC1D14_S42F	5	PRLLFAPEYGPKLKL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P021	Lung	Lung Cancer	SNV	NBPF14	NBPF14_D529H	9	PRLSRELLHEKGPEVLQDSL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3919	Skin	Melanoma	SNV	TRIP12	TRIP12_F1544S	2	PSDTRQMLFY	A01:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide,NEPdb	3
tier2	4	Skin	Melanoma	SNV	PATL1	PATL1_F288Y	10	PSQFARVPGYVGSPLA	DRB1*01:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	4	Skin	Melanoma	SNV	PATL1	PATL1_F288Y	10	PSQFARVPGYVGSPLA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	PTPRK	PTPRK_G677R	11	PYYFAAELPPRNLPEP	DRB1*10:01	PMID:12794170	dentification of a mutated receptor-like protein tyrosine phosphatase kappa as a novel, class II HLA-restricted Melanoma antigen.	Journal of Immunology	2003	https://doi.org/10.4049/jimmunol.170.12.6363	CAPD	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	PIK3CA	PIK3CA_N145S	9	QDFRRNILSVCKEAVDL   	DRB1*16:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	JAK2	JAK2_G180W	6	QEECLWMAV	B40:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Pancreas	Pancreatic Cancer	SNV	HIVEP1	HIVEP1_S1864Y	9	QEFENIKSY	C12:03	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	patient 12	Lung	Lung Cancer	SNV	STAT6	STAT6_G136V	7	QEVGAAVGEL	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	CPSF6	CPSF6_G178E	13	QFEMQSRKTTQSEQMSGEGKAGPPG	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	HACE1	HACE1_N88I	13	QGVVREWFDILSIEIVNPDYALFTQ	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	Patient4	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R175H	9	QHMTEVVRHCPHHER	DRB1*13:01	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide,dbPepNeo	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_G105V	6	QKTYQVSYGFR     	A31:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	12183	Ovary	Ovarian Cancer	SNV	BRAP	BRAP_R534C	3	QLCDVMFYL	A02:01	PMID:29720506	Induction of Neoantigen-Specific Cytotoxic T Cells and Construction of T-cell Receptor-Engineered T Cells for Ovarian Cancer	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0142	dbPepNeo,NeoPeptide	2
tier2	NA	Lung	Lung Cancer	SNV	DENND6B	DENND6B_R398Q 	1	QLLKGVQKK	A11:01	PMID:32793190	Identification of clonal neoantigens derived from driver mutations in an EGFR mutated lung cancer patient benefitting from anti-PD-1	Frontiers in Immunology 	2020	https://www.frontiersin.org/articles/10.3389/fimmu.2020.01366/full	dbPepNeo	1
tier2	P020	Colorectal	Colorectal Cancer	SNV	YBX1	YBX1_P300L	16	QNMYRGYRPRFRRGPLRQRQPREDG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4252	Colorectal	Colorectal Cancer	SNV	SLC2A1	SLC2A1_I272V	3	QPVLIAVVL	B35:03	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	Patient 2	Skin	Melanoma	SNV	PGM5	PGM5_H469Y	8	QQFAVGSYV	A02:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	dbPepNeo,NEPdb	2
tier2	B1203	Lung	Non Small Cell Lung Cancer	SNV	NFYC	NFYC_Q241K	5	QQITKTEV	B52:01	PMID:16287085	A point mutation in the NFYC gene generates an antigenic peptide recognized by autologous cytolytic T lymphocytes on a human squamous cell lung carcinoma	International Journal of Cancer	2006	https://doi.org/10.1002/ijc.21594	NEPdb,dbPepNeo	2
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	PRDM11	PRDM11_E258Q	6	QREKSQQVL	B39:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	AMD1	AMD1_F325L	16	QSAMFNDYNFVFTSLAKKQQQQQS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	6	Skin	Melanoma	SNV	TP63	TP63_S458L	5	QSPSLYGNSSPPLNK	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	5	Skin	Melanoma	SNV	COL22A1	COL22A1_D291N	13	QSTEDVFPQGLPNEY	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Pancreas	Pancreatic Cancer	SNV	GRIK5	GRIK5_R689H	5	QTYQHMWNY	A03:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	patient 6	Lung	Lung Cancer	SNV	RAD1	RAD1_K224N	6	QVNRYNISLLK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P018	Parotid	Parotid Carcinoma	SNV	SOWAHB	SOWAHB_A150G	12	RAADAACNGLPGSGSRRAPGKG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 15	Lung	Lung Cancer	SNV	GAD1	GAD1_S65R	1	RAFKERQSSK	A03:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	SNV	PKHD1	PKHD1_S3369C	10	RALGLPPPVCVFPKTEAEWTASFFN	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Bladder	Primary Bladder Cancer	SNV	CTBP1	CTBP1_Q277R	1	RALKEGRIRGAAL	DRB1*03:01	PMID:31036766	Identification of neoantigen-reactive tumor-infiltrating lymphocytes in primary bladder cancer	Journal Of Immunology	2019	https://doi.org/10.4049/jimmunol.1801022	NeoPeptide	1
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	GLE1	GLE1_I329V	17	RALREMRDLLMNLGQEVTRACEDKRR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P021	Lung	Lung Cancer	SNV	AASS	AASS_D512N	12	RDGNIEITVGSNMKNQIEQLGKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 15	Lung	Lung Cancer	SNV	PTK6	PTK6_H126L	8	RDTQAVRLYK	A03:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4252	Colorectal	Colorectal Cancer	SNV	ENDOG	ENDOG_V121L	6	REDDSLHAY	B44:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	5	Skin	Melanoma	SNV	GRIN2B	GRIN2B_E1104K	5	REFDKIELAY	B41:02	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide	2
tier2	5	Skin	Melanoma	SNV	GRIN2B	GRIN2B_E1104K	5	REFDKIELAYRR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	SLIT3	SLIT3_A513V	4	REGVFDGAASVQELML	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	PCSK9	PCSK9_V202F	9	REIEGRVMF	B18:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide	1
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	PCSK9	PCSK9_V202F	9	REIEGRVMF	B44:02	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide	1
tier2	patient 1	Lung	Lung Cancer	SNV	CUX1	CUX1_R910L	6	REPFVLMQL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	USP47	USP47_F1156L	13	REQCGLELSIDRLRLRKKTWKNPGT	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	IDH2	IDH2_I269M	9	RFKDIFQEM	C14:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	1	Skin	Melanoma	SNV	DCAKD	DCAKD_S199F	2	RFLEYLPLRF	A24:02	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	3	Skin	Melanoma	SNV	ADAMTS7	ADAMTS7_T96I	5	RFNLIANQHLLAPGF	DRB1*07:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	ADAMTS7	ADAMTS7_T96I	5	RFNLIANQHLLAPGF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P013	Skin	Melanoma	SNV	RBMX	RBMX_P167A	12	RGPPPRSVGPPPKRSAA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	A008	Pancreas	Pancreatic Cancer	SNV	TP53	TP53_V25G	2	RGRAMAIYK	A30:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,dbPepNeo	2
tier2	3	Skin	Melanoma	SNV	ADAMTS7	ADAMTS7_T96I	10	RGRELRFNLIANQHLL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	12	Lung	Non-Small-Cell Lung Cancer	SNV	ACP6	ACP6_R101M	4	RGRMQTASL	B07:02	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	3903	Skin	Melanoma	SNV	KIAA1967	KIAA1967_H227Y	10	RHDLPPYRVYL	B38:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P007	Lung	Lung Cancer	SNV	ZNF117	ZNF117_C167Y	11	RIHTGEKPYKYKECGKAFNQTSHLIR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_E709V	5	RILKVTEFK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	3995	Colorectal	Colorectal Cancer	SNV	TUBGCP2	TUBGCP2_P135L	4	RILLVAASY	A30:02	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4097	Ovary	Ovarian Cancer	SNV	INPP5K	INPP5K_L272V	3	RIVWRLKRQPCAGPD	ClassII	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide	1
tier2	P013	Skin	Melanoma	SNV	ATP7B	ATP7B_P31Q	16	RKILSKLSLPTRAWEQAMKKSFAFDNVGYE	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P013	Skin	Melanoma	SNV	MINK1	MINK1_E463K	11	RKQLEEQRQSKRLQRQLQQEHAYLK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	ETV1	ETV1_D38G	9	RKRKFINRGLAHDSEEL       	DRB1*13:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	4271	Colorectal	Colorectal Cancer	SNV	CPSF6	CPSF6_G178E	7	RKTTQSEQM	B15:03	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	3784	Skin	Melanoma	SNV	SON	SON_R1927C	13	RKTVRARSRTPSCRSRSHTPSRRRR	B07:02	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide	2
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	C6orf211	C6orf211_F392V	16	RKWEFSVPFHQALNGVHPAPLCTIRTLKAEI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	INPP5J	INPP5J_C120Y	10	RLAAFGHMLY	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	SNV	ANKHD1	ANKHD1_G60S	16	RLFGEAGPASGVGSSSGGGSGSGTGGGDAALK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	TIL2359	Skin	Melanoma	SNV	KIF2C	KIF2C_A16T	7	RLFPGLTIKI	A02:05	PMID:24987109	Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions	Clinical Cancer Research	2014	https://doi.org/10.1158/1078-0432.CCR-14-0433	NEPdb	1
tier2	3	Skin	Melanoma	SNV	MKLN1	MKLN1_L16F	3	RLFPYALHK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4032	Colorectal	Colorectal Cancer	SNV	API5	API5_R243Q	7	RLLQCTQQAV	A02:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NEPdb	2
tier2	4265	Pancreas	Pancreatic Cancer	SNV	PRPF6	PRPF6_S261T	8	RLSQVSDTV	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	3995	Colorectal	Colorectal Cancer	SNV	RNF213	RNF213_N1702S	8	RMEHFYLSF	A32:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4046	Ovary	Ovarian Cancer	SNV	USP9X	USP9X__Y2009C	8	RMQYSMECF	B15:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	4046	Ovary	Ovarian Cancer	SNV	USP9X	USP9X_Y2009C	8	RMQYSMECFQFMKKL	DPA1*01:03:01/DPB1*04:02:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	NA	Glioma	Diffuse Intrinsic Pontine Glioma (Dipg)	SNV	H3.3	H3.3_K27M	2	RMSAPSTGGV	 A02:01	PMID:29203539	Novel and shared neoantigen derived from histone 3 variant H3.3K27M mutation for glioma T cell therapy	Journal of Clinical Investigation	2018	https://doi.org/10.1084/jem.20171046	dbPepNeo,NeoPeptide	2
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	PCDH12	PCDH12_L865P	10	RNASRENLNPPEPQPATGQ	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	SNV	USP26	USP26_Y860C	10	RNDDKGDHTCRLISVVSHLGKTLKS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 17	Lung	Lung Cancer	SNV	CHMP4C	CHMP4C_G110V	4	RNMVFAAKAMKS	DRB1*08:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	Patient5	Colorectal	Colorectal Cancer	SNV	TP53	TP53_Y220C	12	RNTFRHSVVVPCE	DRB1*04:01	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide,dbPepNeo	2
tier2	P007	Lung	Lung Cancer	SNV	NOTCH2	NOTCH2_C19W	15	RPALLWALLALWLCWAAPAHALQCRDGKKKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P05-TTBK2-S1181L	Skin	Melanoma	SNV	TTBK2	TTBK2_S1088L	9	RPHHDQRSL	B07:02	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	UBR4	UBR4_G4924R	1	RPHVPESAF	B07:02	PMID:16247014	The response of autologous T cells to a human Melanoma is dominated by mutated neoantigens	Proceedings of the National Academy of Sciences	2005	https://doi.org/10.1073/pnas.0500090102	NEPdb	1
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	2	RPIPIKYKA	B07:02	PMID:28811957	Mapping the human T cell repertoire to recurrent driver mutations in MYD88 and EZH2 in Lymphoma	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2017.1321184	NeoPeptide	1
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	2	RPIPIKYKAM	B07:02	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	2	RPIPIKYKAM	C03:03	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	NA	Pancreas	Pancreatic Cancer	SNV	RNF5	RNF5_R105L	9	RPQGQRPAL	B07:02	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	patient 12	Lung	Lung Cancer	SNV	NHEJ1	NHEJ1_S287L	5	RPQLLKVKRKKPR	DRB1*08:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4235	Colorectal	Colorectal Cancer	SNV	GALK1	GALK1_A249V	9	RQCEEVARVL	B49:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	P02	Lung	Non Small Cell Lung Cancer	SNV	BCAR1	BCAR1_V64L	14	RQGIVPGNRLKILLVVPTRVGQGYVYE	DPA1*02:02	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	WHIM35	Breast	Breast Cancer	SNV	PTPRS	PTPRS_R1207W	7	RQLEVPWPYI	A02:01	PMID:28619968	Breast Cancer Neoantigens Can Induce CD8+T-Cell Responses and Antitumor Immunity	Cancer Immunology Research	2017	https://doi.org/10.1158/2326-6066.CIR-16-0264	dbPepNeo,NeoPeptide	2
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	TEP1	TEP1_R2044Q	6	RQLLTQPHK	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	16	Lung	Non-Small-Cell Lung Cancer	SNV	POFUT2	POFUT2_V241L	5	RRSMLFARH	B27:05	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4289	Kidney	Rectal Cancer	SNV	FTCD	FTCD_A316E	13	RRTAALQEGLRREVSVPLTLAETVA	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	MED12L	MED12L_P17S	2	RSRLGPPDVY	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P007	Lung	Lung Cancer	SNV	DCTPP1	DCTPP1_L23F	10	RSSSRKYTEFPHGAISEDQAVGPA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Breast	Breast Cancer	SNV	Gpld1	Gpld1_R829W	7	RSSWGAWLS	H2-Kd	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	SVIL	SVIL_D1285N	8	RTDVKAYNVT	C05:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide,dbPepNeo	2
tier2	3775	Cervix	Cervical Carcinoma(Hpv+)	SNV	METTL17	METTL17_E279K	3	RTKVVQTLW	A32:01	PMID:28408606	Landscape of immunogenic tumor antigens in successful immunotherapy of virally induced epithelial cancer	Science	2017	https://doi.org/10.1126/Science.aak9510	NEPdb,dbPepNeo	2
tier2	P004	Lung	Lung Cancer	SNV	SLC12A7	SLC12A7_V878M	11	RTQAPPTPDKMQMTWTREKLIAEKYRS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	RGS1	RGS1_S158F	5	RTREFTAKK	A03:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	WHIM30	Breast	Breast Cancer	SNV	ROBO3	ROBO3_A1287V	2	RVAGSMSSL	B07:02	PMID:28619968	Breast Cancer Neoantigens Can Induce CD8+T-Cell Responses and Antitumor Immunity	Cancer Immunology Research	2017	https://doi.org/10.1158/2326-6066.CIR-16-0264	dbPepNeo,NeoPeptide	2
tier2	NA	Uterus	Uterine Leiomyosarcoma	SNV	QKI	QKI_R330M	7	RVHPYQMIV	A30:02	PMID:28228279	Loss of PTEN is associated with resistance to anti-PD-1 checkpoint blockade therapy in metastatic uterine leiomyosarcoma	Immunity	2017	https://doi.org/10.1016/j.immuni.2017.02.001	NeoPeptide	1
tier2	P017	Skin	Melanoma	SNV	MMP16	MMP16_H543Y	6	RVKEGYSPPDDVDIVIKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Lung Cancer	SNV	TP53	TP53_A161T	6	RVRAMTIYKQ 	A11:01	PMID:32793190	Identification of clonal neoantigens derived from driver mutations in an EGFR mutated lung cancer patient benefitting from anti-PD-1	Frontiers in Immunology 	2020	https://www.frontiersin.org/articles/10.3389/fimmu.2020.01366/full	dbPepNeo	1
tier2	NA	Pancreas	Pancreatic Cancer	SNV	ILVBL	ILVBL_R183W	3	RVWDIVPTL	A02:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	1	Skin	Melanoma	SNV	TFDP1	TFDP1_V175L	8	RVYDALNLL	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P017	Skin	Melanoma	SNV	TFE3	TFE3_R397C	16	RWNKGTILKASVDYICKLQKEQQRSKDLES	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	A6	Head and Neck	Head And Neck Squamous Cell Carcinoma	SNV	MAGOHB	MAGOHB_G17A	8	RYYVGHKAKF	A24:02	PMID:30906664	Identification of neoantigen-specific T cells and their targets: Implications for immunotherapy of head and neck squamous cell carcinoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1568813	NeoPeptide,dbPepNeo	2
tier2	P01	Lung	Non Small Cell Lung Cancer	SNV	TPBG	TPBG_P57L	14	SAPFLASAVSAQPLLPDQCPALCECSE	A02:06	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	4090	Colorectal	Colorectal Cancer	SNV	RPS15	RPS15_R43Q	6	SARQRQRL	B08:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	CGLU116	Lung	Lung Cancer	SNV	HELB	HELB_P987S	6	SASPLSVV	C15:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-small Cell Lung Cancer	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828	NEPdb,dbPepNeo	2
tier2	NA	Breast	Breast Cancer	SNV	Lrrc27	Lrrc27_G330A	2	SAYQNTVHA	H2-Db	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	Patient10	Kidney	Rectal Cancer	SNV	TP53	TP53_R248W	8	SCMGGMNWRPILTII	DPB1*02:01	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide,dbPepNeo	2
tier2	4238	Colorectal	Colorectal Cancer	SNV	CYFIP1	CYFIP1_I121V	6	SCSRAVPQV	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide	1
tier2	NA	Lung	Lung Cancer	SNV	Rab13	Rab13_K196N	5	SDKKNNKCL	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	P013	Skin	Melanoma	SNV	SP4	SP4_E7K	6	SDQKKKEEEEAAAAAAMATEGKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4071	Colorectal	Colorectal Cancer	SNV	QSOX2	QSOX2_R524W	5	SEDPWFPKL	B40:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4069	Pancreas	Pancreatic Cancer	SNV	ZFYVE27	ZFYVE27_R6H	3	SEHEGSGPEL	B38:01	PMID:26516200	Immunogenicity of somatic mutations in human Colorectal Cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo,NEPdb	2
tier2	patient 16	Lung	Lung Cancer	SNV	FEZ1	FEZ1_M59L	9	SEIISFKSL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4149	Ovary	Ovarian Cancer	SNV	HUWE1	HUWE1_F4353S	1	SEKLRHMLL	B40:02	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	NA	Skin	Melanoma	SNV	TRAPPC1	TRAPPC1_R129G	7	SELFRSGLDS	B44:02	PMID:29217585	Patient HLA class I genotype influences cancer response to checkpoint blockade immunotherapy	Science	2018	https://doi.org/10.1126/Science.aao4572	NA	0
tier2	NA	Skin	Melanoma	SNV	TRAPPC1	TRAPPC1_R129G	7	SELFRSGLDSY	B44:02	PMID:10582700	Two antigens recognized by autologous cytolytic T lymphocytes on a Melanoma result from a single point mutation	Cancer Research	1999	https://cancerres.aacrjournals.org/content/59/22/5785.long	NEPdb,dbPepNeo	2
tier2	patient 12	Lung	Lung Cancer	SNV	ACRBP	ACRBP_K255M	4	SEPMFHSESL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4268	Colorectal	Colorectal Cancer	SNV	RNF149	RNF149_D372H	6	SEPQCHPSF	B18:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P007	Lung	Lung Cancer	SNV	FAM47A	FAM47A_R361L	10	SEPSETGVSLLRLAPPKTRRGSSLH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4293	Colorectal	Colorectal Cancer	SNV	DNMT3A	DNMT3A_P282S	1	SEYEDGRGF	B44:03	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P018	Parotid	Parotid Carcinoma	SNV	XPO5	XPO5_Q206K	16	SFLLNTLQENVNKYQKVKTDTSQESKA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	MAGEC1	MAGEC1_S348Y	4	SFSYTLLSL	DQB1*06:02	PMID:20696919	Fine analysis of spontaneous MAGE-C1/CT7-specific immunity in Melanoma patients.	Proceedings of the National Academy of Sciences	2010	https://doi.org/10.1073/pnas.1002155107	CAPD	1
tier2	2	Skin	Melanoma	SNV	C14orf101	C14orf101_A59D	7	SGELITDAHELGVAH	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	ARSI	ARSI_R171C	11	SGGSNWPLRGCKGTYWEGGVRGL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	LUM	LUM_G248E	5	SGIPENSFNVSSLVE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	RUSC2	RUSC2_S569F	13	SGSPPLRVSVGDFSQ	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	SNRPD1	SNRPD1_T16I	6	SHETVIIEL	B38:01	PMID:16247014	The response of autologous T cells to a human Melanoma is dominated by mutated neoantigens.	Proceedings of the National Academy of Sciences	2005	https://doi.org/10.1073/pnas.0500090102	CAPD	1
tier2	5	Skin	Melanoma	SNV	MAP4K4	MAP4K4_S639L	14	SHLASLKNNVSPVLR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P018	Parotid	Parotid Carcinoma	SNV	TAF2	TAF2_L197F	15	SHMWSQMLVSTSGFFKSISNVSGKDIQPLI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	SNV	NLRC4	NLRC4_D368E	13	SHTQTTLFHTFYELL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	5	Skin	Melanoma	SNV	TBX4	TBX4_S271F	8	SKEYPVIFKSIMRQRL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4097	Ovary	Ovarian Cancer	SNV	HIST1H1B	HIST1H1B_A71D	11	SLAALKKALADGGYD	DRB4*01:01	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide	1
tier2	4097	Ovary	Ovarian Cancer	SNV	HIST1H1B	HIST1H1B_A71D	11	SLAALKKALADGGYD	DQA1*03:01/DQB1*04:02	PMID:29853601	T-cell responses to TP53 hotspot mutations and unique neoantigens expressed by human ovarian cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NEPdb,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	GAS7	GAS7_H225Y	9	SLADEAEVYL	A02:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	patient 12	Lung	Lung Cancer	SNV	RETREG3	RETREG3_R277L	2	SLDEAALPEL	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Kidney	ReNAl Cancer	SNV	HSPA1A	HSPA1A_F293I	8	SLFEGIDIYT	A02:01	PMID:9973436	A hsp70-2 mutation recognized by CTL on a human renal cell carcinoma	Journal of Immunology	1999	https://www.jimmunol.org/content/162/3/1730.long	NEPdb,dbPepNeo	2
tier2	CGLU117	Lung	Non-Small-Cell Lung Cancer	SNV	PVRL4	PVRL4_N430I	5	SLKDISSCSV	B08:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	P021	Lung	Lung Cancer	SNV	ZDHHC5	ZDHHC5_E389K	10	SLKEPTSIAKSSRHPSYRS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	SNV	MAP4K4	MAP4K4_S639L	10	SLKNNVSPVLRSHSF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	IQCE	IQCE_T690M	4	SLPMKNFPV	A02:01	PMID:33123756	Impact of tumor heterogeneity and microenvironment in identifying neoantigens in a patient with ovarian cancer	Cancer Immunology	2021	https://doi.org/10.1007/s00262-020-02764-9	NA	0
tier2	6	Skin	Melanoma	SNV	SMC4	SMC4_L1262F	13	SLRNNMFEISDRFIG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P005	Biliary	Biliary Tract Cancer	SNV	TNKS1BP1	TNKS1BP1_N437G	16	SLVQRRFSEGVLQSPGQDQEKLGGSLAALPQ	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	GREB1L	GREB1_T624L	8	SMRLPLVLDK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	B cell	Lymphoma	SNV	MYD88	MYD88_L265P	9	SPGAHQKRPI	B07:02	PMID:28405493	HLA class I-restricted MYD88 L265P-derived peptides as specific targets for Lymphoma immunotherapy	Oncoimmunology	2017	https://doi.org/10.1080/2162402X.2016.1219825	NeoPeptide	1
tier2	P002	Ovary	Ovarian Cancer	SNV	IRS2	IRS2_K86N	13	SPGEYINIDFGEPGAHLSPPAPPLLASAASS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	SNV	ARHGEF26	ARHGEF26_R318C	15	SPGSLRRGLRSTSYCRAVVSGFDFDSPT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	L012	Lung	Non Small Cell Lung Cancer	SNV	MYADM	MYADM_R30W	9	SPMIVGSPW	B07:02	PMID:26940869	Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade	Science	2016	https://doi.org/10.1126/Science.aaf1490.	NEPdb,dbPepNeo	2
tier2	WHIM30	Breast	Breast Cancer	SNV	PALB2	PALB2_H198D	9	SPVTEIRTDL	B07:02	PMID:28619968	Breast Cancer Neoantigens Can Induce CD8+T-Cell Responses and Antitumor Immunity	Cancer Immunology Research	2017	https://doi.org/10.1158/2326-6066.CIR-16-0264	dbPepNeo,NeoPeptide	2
tier2	patient 6	Lung	Lung Cancer	SNV	CLK3	CLK3_E295Q	2	SQFETLYNEHK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	5	Skin	Melanoma	SNV	ZNF281	ZNF281_G119E	7	SQRTSWEFLQSLVSI	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 17	Lung	Lung Cancer	SNV	DNAJC1	MRGBP_A198R	2	SRAKRRRTL	C07:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	5	Skin	Melanoma	SNV	OVGP1	OVGP1_P446S	15	SRGTTVTPTKETVSLG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	6	Skin	Melanoma	SNV	MLL	MLL_P3239L	13	SRLQTRKNKKLALSS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P006	Colorectal	Colorectal Cancer	SNV	BRD2	BRD2_R528W	10	SRPMSYDEKWQLSLDINKLPGEKLGR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	MAGEC1	MAGEC1_T209A	3	SSALLSIFQSSPE	DQB1*06:02	PMID:20696919	Fine analysis of spontaneous MAGE-C1/CT7-specific immunity in Melanoma patients.	Proceedings of the National Academy of Sciences	2010	https://doi.org/10.1073/pnas.1002155107	CAPD	1
tier2	4266	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R209W	9	SSCMGGMNWR	A68:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P012	Breast	Breast Cancer	SNV	ZNF280A	ZNF280A_D514G	13	SSGMASVIVSNTGPQSSPVKTKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	FAM190A	FAM190A_V195A	10	SSHYKFSKPALQSQS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P02	Lung	Non Small Cell Lung Cancer	SNV	GBF1	GBF1_D1478Y	14	SSQHASRGGQSDDYEDEGVPASYHTVS	B15:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	6	Skin	Melanoma	SNV	DNMBP	DNMBP_H421Y	9	SSQPQVPFYPNLQKSQ	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P06-KIF26B-N256S	Skin	Melanoma	SNV	KIF26B	KIF26B_N256S	2	SSYTGFANK	A11:01	PMID:28678784	Personalized RNA mutanome vaccines mobilize poly-specific therapeutic immunity against cancer	Nature	2017	https://doi.org/10.1038/nature23003	NEPdb,dbPepNeo	2
tier2	patient 2	Lung	Lung Cancer	SNV	NPHP4	NPHP4_R335L	9	STLPPSRSL	C15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_P152L	4	STPLPGTRVR	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	HELB	HELB_P987S	9	STPSASPLSV	C15:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide,NEPdb,dbPepNeo	3
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_T790M	7	STVQLIMQL	C15:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Breast	Breast Cancer	SNV	Gyk	Gyk_K505R	5	STWKRAVM	H2-Kd	PMID:33879241	Optimized polyepitope neoantigen DNA vaccines elicit neoantigen-specific immune responses in preclinical models and in clinical translation	Genome Medicine	2021	https://doi.org/10.1186/s13073-021-00872-4	NA	0
tier2	9	Ovary	Ovarian Cancer	SNV	MAGED2	MAGED2_S598V	2	SVGACGFSY	B35:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	1	Skin	Melanoma	SNV	RUSC2	RUSC2_S569F	5	SVGDFSQEFSPIQEA	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	ANKRD12	ANKRD12_K603T	8	SVKSCKHTEK	A30:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide,NEPdb	2
tier2	3466	Skin	Melanoma	SNV	TEAD1	TEAD1_L209F	9	SVLENFTIFL	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	NEPdb	1
tier2	NCI-3998	Skin	Melanoma	SNV	MED13	MED13_P1691S	6	SVQIISCQY	A30:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	5	Skin	Melanoma	SNV	ZNF281	ZNF281_G119E	3	SWEFLQSLVSIKQEK	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	3678	Skin	Melanoma	SNV	CORO7	CORO7_S33L	13	SWISDIRAGTAPLCRNHIKSSCSLI	B51:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo	1
tier2	patient 16	Lung	Lung Cancer	SNV	SMOX	SMOX_P423S	1	SYFRGSYSY	C07:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Skin	Melanoma	SNV	CTNNB1	CTNNB1_S37F	9	SYLDSGIHF	A24:02	PMID:8642260	A mutated beta-catenin gene encodes a Melanoma-specific antigen recognized by tumor infiltrating lymphocytes	Journal of Experimental Medicine	1996	https://doi.org/10.1084/jem.183.3.1185	NEPdb,dbPepNeo	2
tier2	3678	Skin	Melanoma	SNV	FBXO21	FBXO21_S250Y	2	SYMIMEIEL	C14:02	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	4251	Stomach	Gastric Adenocarcinoma	SNV	COL6A3	COL6A3_G346W	3	TAWQSEDSY	B35:01	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	dbPepNeo	1
tier2	P013	Skin	Melanoma	SNV	SDE2	SDE2_E356A	12	TEERTDGERVAAVAPEERENVAVAKKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4246	Colorectal	Colorectal Cancer	SNV	ARMC9	ARMC9_L146F	4	TEFFPFYAL	B40:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	FAM3C	FAM3C_K193E	2	TESPFEQHI	B44:02	PMID:29217585	Patient HLA class I genotype influences cancer response to checkpoint blockade immunotherapy	Science	2018	https://doi.org/10.1126/Science.aao4572	NeoPeptide	1
tier2	3	Skin	Melanoma	SNV	GTF3C2	GTF3C2_D811N	13	TETVNHHYLLFQNTD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	KRAS	KRAS_G12V	11	TEYKLVVVGAVGVGKSALTIQLIQNH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	2	Skin	Melanoma	SNV	BAZ2A	BAZ2A_S500F	2	TFPAAAFPTASPANKD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	2	Skin	Melanoma	SNV	DDX3X	DDX3X_E388K	5	TFPKKIQMLARDFLD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Skin	Melanoma	SNV	DMXL2	DMXL2_S239L	4	TGFLWRKTSKYMPRGS	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P002	Ovary	Ovarian Cancer	SNV	LMBR1	LMBR1_G273A	11	TGRQVPEEQAAQLLLGKWIQEGGDMI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4266	Colorectal	Colorectal Cancer	SNV	ECI2	ECI2_N352I	2	TIAVVNFLSR	A68:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	patient 8	Lung	Lung Cancer	SNV	FOXF1	FOXF1_E133K	11	TIDPASEFMFK	A11:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P01	Lung	Non Small Cell Lung Cancer	SNV	GPM6B	GPM6B_C94F	14	TILCFSGVALFCGFGHVALAGTVAILE	DQA1*04:01	PMID:33928024	Personal Neoantigens From Patients With NSCLC Induce Efficient Antitumor Responses	Frontiers in Oncology	2021	https://doi.org/10.3389/fonc.2021.628456	NA	0
tier2	11	Skin	Melanoma	SNV	KIAA1958	KIAA1958_E484K	10	TKIPAVKLNKLLENF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	1	Skin	Melanoma	SNV	DCAKD	DCAKD_S199F	15	TKRQVILLHTELERF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	MUC16	MUC16_T11830P	7	TLLVTGPSR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	patient 6	Lung	Lung Cancer	SNV	FANCD2	FANCD2_R1344T	6	TLNNCTEAF	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	SNV	MRPL55	MRPL55_R125H	7	TLSPEEHRARLRKREAQLQSRK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 7	Lung	Lung Cancer	SNV	ADNP2	ADNP2_P584L	12	TNILPVNQPVRLGAS	DRB1*12:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4160	Colorectal	Colorectal Cancer	SNV	APMAP	APMAP_K195T	6	TPIEGTNMSF	B35:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_P152L	3	TPLPGTRVRA	B54:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P019	Stomach	Gastric Carcinoma	SNV	TFPI	TFPI_G213S	15	TPQSTKVPSLFEFHSPSWCLTPADR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	Patient1	B cell	Chronic Lymphocytic Leukemia	SNV	ALMS1	ALMS1_G1001S	7	TPTVPSSSF	B35:01	PMID:24891321	Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia	Blood	2014	https://doi.org/10.1182/blood-2014-04-567933	dbPepNeo	1
tier2	patient 6	Lung	Lung Cancer	SNV	CLSPN	CLSPN_S396F	10	TQIITGSDEF	B15:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	6	Skin	Melanoma	SNV	MLL	MLL_P3239L	9	TRKNKKLALSSTPSN	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	TIL2591	Skin	Melanoma	SNV	POLA2	POLA2_L420F	8	TRSSGSHFVF	C07:01	PMID:24987109	Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions	Clinical Cancer Research	2014	https://doi.org/10.1158/1078-0432.CCR-14-0433	NEPdb	1
tier2	7	Brain	Glioblastoma	SNV	SLX4	SLX4_R1814H	6	TTAATHREK	A68:01	PMID:30568305	Neoantigen vaccine generates intratumoral T cell responses in phase Ib glioblastoma trial	Nature	2019	https://doi.org/10.1038/s41586-018-0792-9	NeoPeptide,dbPepNeo	2
tier2	1	Skin	Melanoma	SNV	NLRC4	NLRC4_D368E	9	TTLFHTFYELLIQKN	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 6	Lung	Lung Cancer	SNV	POLR1G	POLR1G_R292K	9	TVLSPTKKK	A11:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P004	Lung	Lung Cancer	SNV	SHROOM2	SHROOM2_S738C	16	TVPHFWEAGLAQPPSCTSGGPHPPRI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Squamous Cell Carcinoma	SNV	Icam1	Icam1_P315L	8	TVYNFSAL	H2-Kb	PMID:29423108	Cancer immunogenomic approach to neoantigen discovery in a checkpoint blockade responsive murine model of oral cavity squamous cell carcinoma	Oncotarget	2018	https://doi.org/10.18632/Oncotarget.23751	NeoPeptide	1
tier2	NA	Skin	Squamous Cell Carcinoma	SNV	Icam1	Icam1_P315L	8	TVYNFSALV	H2-Kb	PMID:29423108	Cancer immunogenomic approach to neoantigen discovery in a checkpoint blockade responsive murine model of oral cavity squamous cell carcinoma	Oncotarget	2018	https://doi.org/10.18632/Oncotarget.23751	NeoPeptide	1
tier2	NA	Lung	Lung Cancer	SNV	H2-Q2	H2-Q2_D244E	8	TWQLNGEEL	H2-Db	PMID:26112079	Viral Infection of Tumors Overcomes Resistance to PD-1-immunotherapy by Broadening Neoantigenome-directed T-cell Responses	Molecular Therapy	2015	https://doi.org/10.1038/mt.2015.115	NeoPeptide	1
tier2	4136	Breast	Breast Cancer	SNV	CADPS2	CADPS2_R1266H	8	TYDTVHRHL	C04:01	PMID:29867227	Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer	Nature Method	2018	https://doi.org/10.1038/s41591-018-0040-8	NEPdb,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	PRDM10	PRDM10_S1050F	9	TYLPSAWNF	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	NA	Skin	Melanoma	SNV	PRDM10	PRDM10_S1050F	9	TYLPSAWNFF	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	NA	Lung	Lung Cancer	SNV	CEA	CEA_A253V	7	TYYRPGVNLSLSC	DR*07:01	PMID:16585607	Identification of novel subdominant epitopes on the carcinoembryonic antigen recognized by CD4+ T cells of lung cancer patients.	Journal of Immunology	2006	https://doi.org/10.4049/jimmunol.176.8.5093	CAPD	1
tier2	P005	Biliary	Biliary Tract Cancer	SNV	MAD2L1BP	MAD2L1BP_M1V	1	VARVPLGRSLTLSPR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	15	Ovary	Ovarian Cancer	SNV	CLEC10A	CLEC10A_V143F	3	VCFPVHSEM	C12:03	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	dbPepNeo	1
tier2	P006	Colorectal	Colorectal Cancer	SNV	MTIF2	MTIF2_Q204E	16	VDHGKTTLLDKFRKTEVAAVETGGITQHIGA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_H773L;V774M	5,6	VDNPLMCRL	B37:04	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	10	Lung	Non-Small-Cell Lung Cancer	SNV	FERMT1	FERMT1_Q49H	3	VEHINISQDW	B44:02	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	6	Skin	Melanoma	SNV	NCOA6	NCOA6_P1371R	4	VELRRNVLVSPTPLAN	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	HAL	HAL_R18W	9	VERASAIAW	B18:01	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide	1
tier2	Patient 2	Medulloblastoma	Pediatric Medulloblastoma	SNV	HAL	HAL_R18W	9	VERASAIAW	B44:02	PMID:31351799	Low mutational load in pediatric medulloblastoma still translates into neoantigens as targets for specific T-cell immunotherapy	Cytotherapy	2019	https://doi.org/10.1016/j.jcyt.2019.06.009	NeoPeptide	1
tier2	3775	Cervix	Cervical Carcinoma(Hpv+)	SNV	SETDB1	SETDB1_E21D	5	VESEDIAEL	B40:01	PMID:28408606	Landscape of immunogenic tumor antigens in successful immunotherapy of virally induced epithelial cancer	Science	2017	https://doi.org/10.1126/Science.aak9510	NEPdb,dbPepNeo	2
tier2	patient 16	Lung	Lung Cancer	SNV	CHPF	CHPF_D114V	1	VEWLGRCIL	B40:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	mice	B cell	Lymphoma	SNV	KRAS	KRAS_G12D	4	VGADGVGKS	NA	PMID:33298945	A nanoparticle vaccine that targets neoantigen peptides to lymphoid tissues elicits robust antitumor T cell responses	NPJ Vaccines	2020	https://doi.org/10.1038/s41541-020-00253-9	NA	0
tier2	patient 16	Lung	Lung Cancer	SNV	NPBWR1	NPBWR1_G54V	5	VGLAVNSAVLYVLL	DRB1*12:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	CGLU116	Lung	Lung Cancer	SNV	PGAP1	PGAP1_Y903F	10	VIAFGSAHLFR	A31:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-small Cell Lung Cancer	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828	NEPdb,dbPepNeo	2
tier2	5	Skin	Melanoma	SNV	TBX4	TBX4_S271F	3	VIFKSIMRQRLISPQL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	EGFR	EGFR_L858R	8	VKITDFGRAK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	3466	Skin	Melanoma	SNV	TEAD1	TEAD1_L209F	8	VLENFTIFLV	A02:01	PMID:26389673	Isolation of neoantigen-specific T cells from tumor and peripheral lymphocytes	Journal of Clinical Investigation	2015	https://doi.org/10.1172/JCI82416	dbPepNeo,NeoPeptide,NEPdb	3
tier2	Patient1	Skin	Melanoma	SNV	DNAH17	DNAH17_H8302Y	9	VLFEDAVAY	B15:01	PMID:27198675	Targeting of cancer neoantigens with donor-derived T cell receptor repertoires	Science	2016	https://doi.org/10.1126/Science.aaf2288	NA	0
tier2	4081	Colorectal	Colorectal Cancer	SNV	ALDOC	ALDOC_R69H	8	VLFSADDHV	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	SLC30A1	SLC30A1_L131H	16	VLGVGVAGLLVNVLGHCLFHHHSGFSQDSG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3466	Skin	Melanoma	SNV	COL181A	COL181A_S126F	8	VLLGVKLFGV	A02:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P015	Biliary	Biliary Tract Cancer	SNV	FAM86A	FAM86A_K215N	NA	VLLNGLSLEADITANLDSPRVTVAQLKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	ATN1	ATN1_Q1117H	5	VLRHHLFAA	A02:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P004	Lung	Lung Cancer	SNV	GREM2	GREM2_A29T	16	VLVKVAEARKNRPAGTIPSPYKDGS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Pancreas	Pancreatic Cancer	SNV	MUC16	MUC16_Q13957K	3	VMKHLLSPL	B08:01	PMID:29132146	Identification of unique neoantigen qualities in long-term survivors of Pancreatic Cancer	Nature	2017	https://doi.org/10.1038/Nature24462	dbPepNeo	1
tier2	CGLU127	Lung	Non-Small-Cell Lung Cancer	SNV	SLC38A2	SLC38A2_V275M	8	VPALSHNM	B42:01	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	patient 15	Lung	Lung Cancer	SNV	NCKAP5L	NCKAP5L_Q718K	10	VPSIHRPLEK	A03:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_G105V	9	VPSQKTYQVSYGFRLGF   	DQB1*06:03	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NCI-3998	Skin	Melanoma	SNV	MED13	MED13_P1691S	5	VQIISCQY	A30:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NEPdb	2
tier2	NCI-3998	Skin	Melanoma	SNV	MED13	MED13_P1691S	5	VQIISCQY	B15:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	SFSWAP	SFSWAP_A365G	16	VQPSQVEYTADSTVAGMYYSYYMLPDGTYCLKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 8	Lung	Lung Cancer	SNV	DHX30	DHX30_S1052F	4	VRDFSQVHPLAVLL	DRB1*04:05	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	12	Lung	Non-Small-Cell Lung Cancer	SNV	RBBP6	RBBP6_G499V	9	VRINTARPV	C06:02	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P006	Colorectal	Colorectal Cancer	SNV	CDYL2	CDYL2_V254I	14	VRQNESNCRFRDIIVRKEEGFTHILLSSQT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	3	Skin	Melanoma	SNV	CIT	CIT_P2056L	4	VRTLLSQVNK	B27:05	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	5	Skin	Melanoma	SNV	MED24	MED24_V981M	5	VSELMKVSAMSSPKV	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	FUCA2	FUCA2_C329F	3	VSFGGNLLM	C15:02	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P021	Lung	Lung Cancer	SNV	VPS13C	VPS13C_L1781P	10	VSPNAVIADPGLIRVENKFSLVPMEH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	SNV	ABCC5	ABCC5_T1046K	15	VSRVLIRELKRLDNIKQSPFLSHITSSIQGL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NCI-3998	Skin	Melanoma	SNV	MED13	MED13_P1691S	7	VSVQIISCQY	A30:02	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	NCI-3998	Skin	Melanoma	SNV	MED13	MED13_P1691S	7	VSVQIISCQY	A01:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide	2
tier2	4242	Stomach	Stomach Cancer	SNV	CDC42BPA	CDC42BPA_D428Y	11	VTAGPTSLDLY	A01:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	P018	Parotid	Parotid Carcinoma	SNV	MUC4	MUC4_V3353A	7	VTDTSSASTGHATPLPVTGLSS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	2	Skin	Melanoma	SNV	ITGA9	ITGA9_L548P	7	VTEKLQPTY	A01:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	6	Skin	Melanoma	SNV	FAM50B	FAM50B_E78K	11	VTLNDMKARQKALVR	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	CGLU116	Lung	Non-Small-Cell Lung Cancer	SNV	NKD2	NKD2_D143E	5	VTREEMSSLM	C12:02	PMID:28031159	Evolution of Neoantigen Landscape during Immune Checkpoint Blockade in Non-Small Cell Lung Cancer.	Cancer Discovery	2017	https://doi.org/10.1158/2159-8290.CD-16-0828.	NeoPeptide	1
tier2	A018	Lung	Lung Cancer	SNV	KRAS	KRAS_G12A	5	VVGAAGVGK	A11:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	A005	Uterus	Endometrial Cancer	SNV	KRAS	KRAS_G12C	5	VVGACGVGK	A11:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	A020	Pancreas	Pancreatic Cancer	SNV	KRAS	KRAS_G12D	5	VVGADGVGK	A11:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	C002	Pancreas	Pancreatic Cancer	SNV	KRAS	KRAS_G12V	5	VVGAVGVGK	A11:01	PMID:30835255	Neoantigen identification strategies enable personalized immunotherapy in refractory solid tumors	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI99538	NeoPeptide,NEPdb,dbPepNeo	3
tier2	Patient2	B cell	Chronic Lymphocytic Leukemia	SNV	FNDC3B	FNDC3B_L294M	3	VVMSWAPPV	A02:01	PMID:24891321	Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia	Blood	2014	https://doi.org/10.1182/blood-2014-04-567933	dbPepNeo	1
tier2	SCCHN	Head and Neck	Head And Neck Cancer	SNV	TP53	TP53_Y220C	4	VVPCEPPEV	A02:01	PMID:17294448	Immunological characterization of missense mutations occurring within cytotoxic T cell defined p53 epitopes in HLA A0201 squamous cell carcinomas of the head and neck	International Journal of Cancer	2007	https://doi.org/10.1002/ijc.22584	NEPdb	1
tier2	4259	Colorectal	Colorectal Cancer	SNV	TP53	TP53_Y181C	4	VVPCEPPEV	C05:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	Skin	Melanoma	SNV	B4GAT1	B4GAT1_A259V	4	VVPVFEIRRARRMPMN	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient4	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R175H	4	VVRHCPHHERCSDSD	DRB1*13:01	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide	1
tier2	NA	Pancreas	Pancreatic Adenocarcinoma	SNV	KRAS	KRAS_G12V	6	VVVGAVGVG	B35	PMID:9311595	Cytotoxic CD4+ and CD8+ T lymphocytes, generated by mutant p21-ras (12Val) peptide vaccination of a patient, recognize 12Val-dependent nested epitopes present within the vaccine peptide and kill autologous tumour cells carrying this mutation.	International Journal of Cancer	1997	https://doi.org/10.1002/(sici)1097-0215(19970904)72:5%3C784::aid-ijc14%3E3.0.co;2-9	CAPD	1
tier2	10	Lung	Non-Small-Cell Lung Cancer	SNV	AJUBA	AJUBA_D390Y	6	VYCEEYYLF	A24:02	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	NA	Skin	Melanoma	SNV	INSIG1	INSIG1_S238F	6	VYQYTFPDF	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	NA	Skin	Melanoma	SNV	INSIG1	INSIG1_S238F	6	VYQYTFPDFL	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	3678	Skin	Melanoma	SNV	XPNPEP1	XPNPEP1_S639T	10	WLIRETQPITK	A03:01	PMID:27827318	Isolation of T-Cell Receptors Specifically Reactive with Mutated Tumor-Associated Antigens from Tumor-Infiltrating Lymphocytes Based on CD137 Expression	Clinical Cancer Research	2017	https://doi.org/10.1158/1078-0432.CCR-16-2680	dbPepNeo,NeoPeptide,NEPdb	3
tier2	3	Skin	Melanoma	SNV	CASP1	CASP1_P172S	8	WRNILLLSLH	B27:05	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	6	Skin	Melanoma	SNV	CADM4	CADM4_NeoORF	7	WRTRGAISASSTQKT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	4112	Bile buct	Bile Duct Cancer	SNV	NBAS	NBAS_C144S	5	WSYDSTLLAY	A25:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4252	Colorectal	Colorectal Cancer	SNV	NUP85	NUP85_G349D	3	YFDSNMREFLLL	C04:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	1	Ovary	Ovarian Cancer	SNV	SSC4D	SSC4D_D85Y	9	YGTGHILLY	B35:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	2	Ovary	Ovarian Cancer	SNV	SSC4D	SSC4D_D85Y	9	YGTGHILLY	C12:03	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	NCI-3903	Skin	Melanoma	SNV	KIF1BP	KIF1BP_P246S	3	YHSIEWAI	B38:01	PMID:26901407	Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of Melanoma patients	Nature Method	2016	https://doi.org/10.1038/nm.4051	dbPepNeo,NeoPeptide,NEPdb	3
tier2	P008	Pancreas	Pancreatic Carcinoma	SNV	MYO3B	MYO3B_D580Y	12	YIADETGRVMHYITSKESYRRQFEAIQ	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P010	Colorectal	Colorectal Cancer	SNV	AREL1	AREL1_G43A;S52N	16,25	YKIFQPGIGSHYVAQAGLELLDSSNLPALAF	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	NA	NA	SNV	KRAS	KRAS_G13R	10	YKLVVVGAGRVGKSALTIQ 	NA	PMID:33086698	Healthy Donors Harbor Memory T Cell Responses to RAS Neo-Antigens	Cancers	2020	https://www.mdpi.com/2072-6694/12/10/3045	NA	0
tier2	NA	NA	NA	SNV	KRAS	KRAS_G13V	10	YKLVVVGAGVVGKSALTIQ 	NA	PMID:33086698	Healthy Donors Harbor Memory T Cell Responses to RAS Neo-Antigens	Cancers	2020	https://www.mdpi.com/2072-6694/12/10/3045	NA	0
tier2	Patient3	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R175H	13	YKQSQHMTEVVRHCPHHERCSDSDG	Class II	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide	1
tier2	P021	Lung	Lung Cancer	SNV	ZAN	ZAN_N2411S	15	YKVQLQAGLELVVNSQKMAVPYRPNEHLRV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	SNV	TTC37	TTC37_A692V	6	YLDGKVVDY	A01:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	9	Skin	Melanoma	SNV	TTC37	TTC37_A692V	6	YLDGKVVDY	A11:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	SNV	CTNNB1	CTNNB1_S38P	16	YLDSGIHSGATTTAPPLSGKG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P006	Colorectal	Colorectal Cancer	SNV	EFNA5	EFNA5_D72A	16	YLDVFCPHYEDSVPEAKTERYVLYMVNFDGY	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	patient 4	Lung	Lung Cancer	SNV	KIF1A	KIF1A_P1587L	7	YLHFLELHT	A02:03	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	NA	Ovary	Ovarian Cancer	SNV	UBE2E3	UBE2E3_S168Y	1	YLLTDCNPA	A02:01	PMID:33123756	Impact of tumor heterogeneity and microenvironment in identifying neoantigens in a patient with ovarian cancer	Cancer Immunology	2021	https://doi.org/10.1007/s00262-020-02764-9	NA	0
tier2	16	Lung	Non-Small-Cell Lung Cancer	SNV	ARHGAP42	ARHGAP42_G291V	6	YLNEAVFNFV	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4241	Colorectal	Colorectal Cancer	SNV	CCAR2	CCAR2_R86W	8	YLQPGPPWRL	C04:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4238	Colorectal	Colorectal Cancer	SNV	NCKAP1	NCKAP1_D438Y	6	YLSGFYAVV	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	4032	Colorectal	Colorectal Cancer	SNV	RNF10	RNF10_E483K	10	YLSHLPLTCK	A03:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	12832	Ovary	Ovarian Cancer	SNV	RFC5	RFC5_K160N	4	YLSNIIPAL	A02:01	PMID:29720506	Induction of Neoantigen-Specific Cytotoxic T Cells and Construction of T-cell Receptor-Engineered T Cells for Ovarian Cancer	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0142	dbPepNeo,NeoPeptide	2
tier2	12832	Ovary	Ovarian Cancer	SNV	GINS1	GINS1_I87V	9	YLYDRLLRV	A02:01	PMID:29720506	Induction of Neoantigen-Specific Cytotoxic T Cells and Construction of T-cell Receptor-Engineered T Cells for Ovarian Cancer	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0142	dbPepNeo,NeoPeptide	2
tier2	1	Skin	Melanoma	SNV	USP7	USP7_D789Y	1	YLYHRVDVI	A02:01	PMID:33038342	Key Parameters of Tumor Epitope Immunogenicity Revealed Through a Consortium Approach Improve Neoantigen Prediction	Cell	2020	https://doi.org/10.1016/j.cell.2020.09.015	NA	0
tier2	4	Skin	Melanoma	SNV	MKNK1	MKNK1_P265S	4	YMASEVVEVFTDQAT	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	Patient8	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R248Q	13	YMCNSSCMGGMNQRPILTIITLEDS	Class I and II	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	NeoPeptide	1
tier2	NA	Skin	Melanoma	SNV	TYR	TYR_N371D	3	YMDGTMSQV	A02:01	PMID:25645385	Exploration of peptides bound to MHC class I molecules in Melanoma	Pigment Cell & Melanoma Research	2015	https://doi.org/10.1111/pcmr.12357	dbPepNeo	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	ATM	ATM_S2408L	5	YMKSLEFENK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	FGFR1	FGFR1_R734W	5	YMMMWDCWHA	A02:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	FGFR1	FGFR1_R734W	5	YMMMWDCWHAV	A02:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	D14	Skin	Melanoma	SNV	WASL	WASL_P351L	9	YPPPPPALL	A07:02	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NA	0
tier2	5	Skin	Melanoma	SNV	TBX4	TBX4_S271F	5	YPVIFKSIM	B35:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo,NeoPeptide,NEPdb	3
tier2	NA	Lung	Non-Small-Cell Lung Cancer	SNV	TP53	TP53_G105V	3	YQVSYGFRL	B37:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Skin	Melanoma	SNV	INSIG1	INSIG1_S238F	5	YQYTFPDF	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo,NeoPeptide	2
tier2	NA	Skin	Melanoma	SNV	INSIG1	INSIG1_S238F	5	YQYTFPDFLY	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo	1
tier2	P001	Skin	Melanoma	SNV	GIMAP6	GIMAP6_R251M	16	YQYTQQNFRLKELQEMQVSQGQGS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Melanoma	SNV	MMS22L	MMS22L_S437F	8	YSKNLNSFF	A24:02	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo	1
tier2	patient 16	Lung	Lung Cancer	SNV	TPGS2	TPGS2_L118V	9	YSLPNAPTV	A02:10	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	4046	Ovary	Ovarian Cancer	SNV	USP9X	USP9X__Y2009C	5	YSMECFQFM	C03:03	PMID:29720506	T-cell Responses toTP53鈥淗otspot鈥Mutations and Unique Neoantigens Expressed by Human Ovarian Cancers	Clinical Cancer Research	2018	https://doi.org/10.1158/1078-0432.CCR-18-0573	NeoPeptide,NEPdb	2
tier2	4271	Colorectal	Colorectal Cancer	SNV	NBPF8	NBPF8_S116L	13	YSTLSIPPEMLALYKSYSSTFHSLE	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	NA	Skin	Melanoma	SNV	PPP1R3B	PPP1R3B_P176H	5	YTDFHCQYV	A01:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	CAPD,dbPepNeo,NEPdb	3
tier2	NA	Skin	Melanoma	SNV	PPP1R3B	PPP1R3B_P176H	5	YTDFHCQYVK	A01:01	PMID:23644516	Mining exomic sequencing data to identify mutated antigens recognized by adoptively transferred tumor-reactive T cells	Nature Method	2013	https://doi.org/10.1038/nm.3161	dbPepNeo,NEPdb	2
tier2	4166	Colorectal	Colorectal Cancer	SNV	NPLOC4	NPLOC4_I312V	12	YTFSISQNPFPV	A02:01	PMID:31164343	Unique Neoantigens Arise  from Somatic Mutations in Patients with Colorectal Cancers	Cancer Discovery	2019	https://doi.org/10.1158/2159-8290.CD-18-1494	NeoPeptide,dbPepNeo	2
tier2	NA	B cell	Acute Myelogenous Leukemia	SNV	FLT3	FLT3_D560Y	10	YVDFREYEYY	A01:01	PMID:17119119	A neoepitope generated by an FLT3 internal tandem duplication (FLT3-ITD) is recognized by leukemia-reactive autologous CD8+ T cells.	Blood	2007	https://doi.org/10.1182/blood-2006-07-032839	CAPD	1
tier2	20	Ovary	Ovarian Cancer	SNV	DDX60L	DDX60L_V257G	7	YVIFDEGHY	A25:01	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	23	Ovary	Ovarian Cancer	SNV	DDX60L	DDX60L_V257G	7	YVIFDEGHY	A26:03	PMID:31069153	Neoantigens retention in patient derived xenograft models mediates autologous T cells activation in ovarian cancer	Oncoimmunology	2019	https://doi.org/10.1080/2162402X.2019.1586042	NeoPeptide,dbPepNeo	2
tier2	D14	Skin	Melanoma	SNV	PABPC3	PABPC3_R424Q	9	YYPPSQIAQL	A24:02	PMID:26048577	Exome Sequencing to Predict Neoantigens in Melanoma	Cancer Immunology Research	2015	https://doi.org/10.1158/2326-6066.CIR-15-0088	NA	0
tier2	NA	Skin	Melanoma	SNV	MMS22L	MMS22L_S437F	9	YYSKNLNSF	A24:03	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	MMS22L	MMS22L_S437F	9	YYSKNLNSFF	A24:04	PMID:28423700	HLA class I loss in metachronous metastases prevents continuous T cell recognition of mutated neoantigens in a human Melanoma model	Oncotarget	2017	https://doi.org/10.18632/Oncotarget.16048	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ABCC1	ABCC1_P1094S	3	YYSSIVANRWLAVRLE	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Brain	Glioblastoma	SNV	MEGF8	MEGF8_P238S	7	AGAFLSSPGLLAVFG	DRB1*01:01	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	NUP210	NUP210_S427F	8	AIDAALTFV	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	GDF5	GDF5_K806R	10	ALFLVFGRTRK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	LIPE	LIPE_A857E	15	ALPLSEPMRRSVSEE	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ZNF878	ZNF878_T216A	10	ALSYLVSFQR	A11:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	SLC25A19	SLC25A19_N133S	10	ARLQFSCYSSL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	CTE-0010	Ovary	Ovarian Cancer	SNV	EBF4	NA	NA	ASMPSSPPL	B15:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CLCN4	CLCN4_A298T	2	ATLVAAFTL	B15:07	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CLCN4	CLCN4_A298T	2	ATLVAAFTL	C07:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	ETV078	B cell	Leukemia	SNV	GPR139	GPR139_A298T	2	ATTLKAFFK	A03:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ERG016	B cell	Leukemia	SNV	ACE2	ACE2_D615Y	2	AYQSIKVRI	A24:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	BMPER	BMPER_E651K	10	CIKTCDNWNK	A11:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ERCC8	ERCC8_L349F	10	CVFQSNFQEF	A23:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ERCC8	ERCC8_L349F	10	CVFQSNFQEF	B15:17	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ERCC8	ERCC8_L349F	10	CVFQSNFQEF	C02:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	P4	Liver	Hepatocellular Carcinoma	SNV	C5orf42	C5orf42_I1134K	13	DADILSETFQLLK	A11:01	PMID:31887370	Heterogeneous immunogenomic features and distinct escape mechanisms in multifocal hepatocellular carcinoma	Journal of hepatology	2020	https://doi.org/10.1016/j.jhep.2019.12.014	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	IFT80	IFT80_H63T	9	DDIYPIDFY	A25:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	1	Skin	Melanoma	SNV	RUSC2	RUSC2_S569F	2	DFSQEFSPIQEAQQD	DRB1*04:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	PTPRU	PTPRU_P783L	9	DHYAYSYYL	C06:02	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	P4	Liver	Hepatocellular Carcinoma	SNV	C5orf42	C5orf42_I1134K	11	DILSETFQLLK	A11:01	PMID:31887370	Heterogeneous immunogenomic features and distinct escape mechanisms in multifocal hepatocellular carcinoma	Journal of hepatology	2020	https://doi.org/10.1016/j.jhep.2019.12.014	dbPepNeo	1
tier2	patient2	Bone	Myeloma	SNV	EVI2B	EVI2B_G327A	9	DSADGSTVATA	A68:02	PMID:31857430	Mutation-derived Neoantigen-specific T-cell Responses in Multiple Myeloma	Clinical?Cancer?Research	2020	https://doi.org/10.1158/1078-0432.ccr-19-2309	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	WDR1	WDR1_N544K	10	DSFAGKGHTK	A68:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	KCNC3	KCNC3_P715L	4	DYALSPDGSIRKATG	DPA1*01:03/DPB1*04:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	CTE-0005	Ovary	Ovarian Cancer	SNV	HS6ST1	HS6ST1_S405I	4	DYMIHIIEKW	A23:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	4	Skin	Melanoma	SNV	TNR	TNR_R1007W	4	EEFWLVDLLPSTHYT	DQA1*01:01/DQB1*05:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	Pt 005	Ovary	Ovarian Cancer	SNV	IL27RA	IL27RA_P594L	6	EEMEPLPVM	B44:03	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	Pt 015	Ovary	Ovarian Cancer	SNV	FCGBP	FCGBP_A1177V	4	EGFVLSGESCLPLA	DPA1*02:02/DPB1*03:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	ENAH	ENAH_A706V	13	EMSALLARRRRIVEK	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	VARS	NA	NA	EVADEAMGAL	A25:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	MYLK	NA	NA	EVFPEDTVTY	A25:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	4285	Colorectal	Colorectal Cancer	SNV	TP53	TP53_R175H	5	EVVRHCPHHER	DRB1*13:01	PMID:31996390	Antigen Experienced T Cells from Peripheral Blood Recognize p53 Neoantigens	Clinical?Cancer?Research	2020	https://doi.org/10.1158/1078-0432.ccr-19-1874	dbPepNeo	1
tier2	NA	Ovary	Ovarian Cancer	SNV	ARFGEF1	ARFGEF1_S280I	3	FAIADTAYV	A02:01	PMID:32660279	Intranodal Administration of Neoantigen Peptide-loaded Dendritic Cell Vaccine Elicits Epitope-specific T Cell Responses and Clinical Effects in a Patient with Chemorefractory Ovarian Cancer with Malignant Ascites	Immunological Investigations	2021	https://doi.org/10.1080/08820139.2020.1778721	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	1	FFFFKTTAL	B08:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	1	FFFFKTTAL	C01:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	1	FFFFKTTAL	C07:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	1	FFFFKTTAL	C07:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	1	FFFFKTTAL	C12:03	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	Pt 015	Ovary	Ovarian Cancer	SNV	CCR6	CCR6_V67L	4	FGLLGNILLVI	A02:24	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	Pt 015	Ovary	Ovarian Cancer	SNV	CCR6	CCR6_V67L	4	FGLLGNILLVI	DPA1*02:02/DPB1*03:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	CTE-0012	Ovary	Ovarian Cancer	SNV	PDPN	PDPN_G222C	3	FICAIIVVV	A02:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ZIM3	ZIM3_L322F	7	FIYKSDFVK	A03:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Ovary	Ovarian Cancer	SNV	PPM1F	PPM1F_C259Y	7	FLAPLFLVLL	A24:02	PMID:32660279	Intranodal Administration of Neoantigen Peptide-loaded Dendritic Cell Vaccine Elicits Epitope-specific T Cell Responses and Clinical Effects in a Patient with Chemorefractory Ovarian Cancer with Malignant Ascites	Immunological Investigations	2021	https://doi.org/10.1080/08820139.2020.1778721	dbPepNeo	1
tier2	CTE-0002	Ovary	Ovarian Cancer	SNV	HLA-DRB1	HLA-DRB1_I248L	8	FLGAGLFLYF	A02:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	ADARB1	ADARB1_S484F	1	FLLRFLYTQL	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	SLC27A3	SLC27A3_Y704C	8	FLQEVNVCGV	A02:03	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	NA	Ovary	Ovarian Cancer	SNV	PPOX	PPOX_R441S	6	FLTAHSLPL	A02:01	PMID:32660279	Intranodal Administration of Neoantigen Peptide-loaded Dendritic Cell Vaccine Elicits Epitope-specific T Cell Responses and Clinical Effects in a Patient with Chemorefractory Ovarian Cancer with Malignant Ascites	Immunological Investigations	2021	https://doi.org/10.1080/08820139.2020.1778721	dbPepNeo	1
tier2	KADA	Skin	Melanoma	SNV	WDR75	WDR75_S749F	1	FMFVNSLLL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	ETV084	B cell	Leukemia	SNV	ANKS1A	ANKS1A_E434K	7	FPLTASKVL	B35:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ERCC8	ERCC8_L349F	8	FQSNFQEFY	A01:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ERCC8	ERCC8_L349F	8	FQSNFQEFY	C02:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	UGT2B7	UGT2B7_D492N	7	FQYHSLNVI	A02:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	UGT2B7	UGT2B7_D492N	7	FQYHSLNVI	C02:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	UGT2B28	UGT2B28_D492N	7	FQYHSLNVI	C07:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	ZNF567	ZNF567_D153N	9	FRQKTNLIL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	CTSF	CTSF_T246S	3	FRSIYLNTLL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	A01:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	A24:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	A26:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	C07:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	C07:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CNTNAP5	CNTNAP5_S816F	6	FSADIFFFF	C12:03	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	Pt 015	Ovary	Ovarian Cancer	SNV	FCGBP	FCGBP_A1177V	2	FVLSGESCLPL	A02:06	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	19	Renal	Renal Rell Carcinoma	SNV	ATP5L	ATP5L_E799D	8	FWYYAKVDL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Brain	Glioblastoma	SNV	WDR3	WDR3_T690M	8	FYNDIILMV	C06:02	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	CTE-0019	Ovary	Ovarian Cancer	SNV	ODZ3	ODZ3_A2490V	9	GAQSWLWFV	A02:11	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	Pt 019	Ovary	Ovarian Cancer	SNV	DNAH8	DNAH8_R3179S	7	GEKFRASSLKFPGL	DPA1*03:01/DPB1*03:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	NA	Brain	Glioblastoma	SNV	PTEN	PTEN_R47S	12	GFPAERLEGVYSNNI	DRB1*01:01	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	NA	Brain	Glioblastoma	SNV	NVL	NVL_I644V	5	GLNFVSVKGPELLNM	DRB1*01:01	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	CTE-0015	Ovary	Ovarian Cancer	SNV	ZCCHC11	ZCCHC11_P1265H	8	GRKLFGTHF	B27:05	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	SNV	TMEM14B	TMEM14B_N302L	7	GRQSWSLYV	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	HSF5	HSF5_V444I	9	GSDIMSFVI	C02:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	HSF5	HSF5_V444I	9	GSDIMSFVI	C05:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	C20orf27	C20orf27_C156Y	3	GTYVRVTVQAR	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	7	HELMTLHGF	B18:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	7	HELMTLHGFM	B18:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	ARHGAP28	ARHGAP28_N673E	8	HIIRLMLEY	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	ETV085	B cell	Leukemia	SNV	CD101	CD101_S889F	9	HLHCYRSSF	B15:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ETV078	B cell	Leukemia	SNV	PCNXL2	PCNXL2_F1180L	5	HLMWLERLY	A03:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ETV084	B cell	Leukemia	SNV	ATP13A4	ATP13A4_L109F	3	HPFMTDEEY	B35:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	MKLN1	MKLN1_R468C	5	HSKNCCLYVF	C02:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	MKLN1	MKLN1_R468C	5	HSKNCCLYVF	C16:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	MPO	MPO_R1251W	6	HTLLLWEHNR	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	LOX	LOX_G350D	8	HTQGLSPDCY	A01:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	LOXL1	LOXL1_G507D	8	HTQGLSPDCY	B15:17	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	Patient7	Ovary	Ovarian Cancer	SNV	TP53	TP53_G245S	13	HYNYMCNSSSCMGSMN	DRB3*02:02	PMID:30714987	Neoantigen screening identifies broadTP53mutant immunogenicity in patients with epithelial cancers	Journal of Clinical Investigation	2019	https://doi.org/10.1172/JCI123791	dbPepNeo	1
tier2	Pt 011	Ovary	Ovarian Cancer	SNV	JAK1	JAK1_N936I	11	IEILRNLYHEIIV	DRB4*01:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	RMM-03	Bone	Myeloma	SNV	S100A9	S100A9_T18N	7	IETIINNFHQY	B44:03	PMID:31857430	Mutation-derived Neoantigen-specific T-cell Responses in Multiple Myeloma	Clinical?Cancer?Research	2020	https://doi.org/10.1158/1078-0432.ccr-19-2309	dbPepNeo	1
tier2	4	Skin	Melanoma	SNV	ARHGAP29	ARHGAP29_G670E	5	IHLFEAEFTQVAKKEPDG	DRB1*01:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	MEL69	Skin	Melanoma	SNV	SIPA1L3	SIPA1L3_S893F	5	ILGISNEFV	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	P4	Liver	Hepatocellular Carcinoma	SNV	C5orf42	C5orf42_I1134K	10	ILSETFQLLK	A11:01	PMID:31887370	Heterogeneous immunogenomic features and distinct escape mechanisms in multifocal hepatocellular carcinoma	Journal of hepatology	2020	https://doi.org/10.1016/j.jhep.2019.12.014	dbPepNeo	1
tier2	KADA	Skin	Melanoma	SNV	KDELR2	KDELR2_T121I	4	ILWIFSIYL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	NA	Liver	Liver Cancer	SNV	CTNNB1	CTNNB1_K335I	9	IMRTYTYEI	A02:01	PMID:32934692	Point mutation screening of tumor neoantigens and peptide-induced specific cytotoxic T lymphocytes using The Cancer Genome Atlas database	Oncology?Letters	2020	https://doi.org/10.3892/ol.2020.11986	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	RASAL2	RASAL2_P637S	4	IMSSSLFNL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	19	Renal	Renal Rell Carcinoma	SNV	SAMD9	SAMD9_I853L	7	IPDSIALIQQL	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	OR5K3	OR5K3_NA	3	IQMFTIVLVSY	B44:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	RAB39B	RAB39B_W138R	2	IRLYQFRLIV	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	RAB39B	RAB39B_W138R	2	IRLYQFRLIVI	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	ERG016	B cell	Leukemia	SNV	MCTP1	MCTP1_R783H	5	IRMKHCVMV	C07:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	TRBV5-1	TRBV5-1_S52F	8	ISGHRSVFWY	A01:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	TRBV5-1	TRBV5-1_S52F	8	ISGHRSVFWY	A29:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	TRBV5-1	TRBV5-1_S52F	8	ISGHRSVFWY	B58:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	OR4C6	OR4C6_S50C	3	ITCQSLRSPMY	A01:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	FZD6	FZD6_P30A	4	ITVARCMKMAY	A01:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	PARP4	PARP4_T1170I	7	KENSLIIQF	B18:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	SNV	ABCC12	ABCC12_Q662K	1	KFLESCDEVI	A24:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	MEL69	Skin	Melanoma	SNV	ERCC6L	ERCC6L_V476I	7	KIYRRQVFK	A11:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	MEL69	Skin	Melanoma	SNV	RUFY1	RUFY1_K225N	7	KLADYLKVL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	ETV001	B cell	Leukemia	SNV	SPATA5	SPATA5_S812C	6	KLQFHCMPV	A02:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Renal	Renal Rell Carcinoma	SNV	KRAS	KRAS_G12D	8	KLVVVGADGV	A02:03	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	CTE-0013	Ovary	Ovarian Cancer	SNV	HHAT	HHAT_L75F	8	KQWLVWLFL	A02:06	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	PRICKLE3	PRICKLE3_G566L	1	KRIPLPPHLC	C06:02	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ZIM3	ZIM3_L322F	4	KSDFVKHQRI	B15:17	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	ZIM3	ZIM3_L322F	4	KSDFVKHQRI	C08:02	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	VPS16	VPS16_S404F	8	KSLLRAAFFGKCFLDR	DPA1*01:03/DPB1*04:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	MEL69	Skin	Melanoma	SNV	SMARCC2	SMARCC2_S624F	3	KVFEHVGSR	A11:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	8	Skin	Melanoma	SNV	RAD51AP1-002	NA	NA	KVKFPVEKK	A03:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	CTE-0010	Ovary	Ovarian Cancer	SNV	TRIM26	TRIM26_G497W	5	LDYEWGTVTF	B15:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	ETV085	B cell	Leukemia	SNV	TMEM104	TMEM104_V281I	6	LFGVCIYSF	A24:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	GTF3C2	GTF3C2_D811N	4	LFQNTDLGSFHDLLR	DQA1*01:01/DQB1*05:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	ETV084	B cell	Leukemia	SNV	SLC6A7	SLC6A7_R62C	6	LGNVWCFPY	B35:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Brain	Glioblastoma	SNV	NUP107	NUP107_R558H	6	LILFFHTLGLQTKEE	DRB1*01:01	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	Pt 003	Ovary	Ovarian Cancer	SNV	KCNH1	KCNH1_K703N	9	LILTYNLRNRIVFR	DPA1*02:01/DPB1*09:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	NA	Lung	Non-Small Cell Lung Cancer	SNV	EGFR	EGFR_T790M	3	LIMQLMPFGCL	A02:01	PMID:24223798	EGFR T790M mutation as a possible target for immunotherapy; identification of HLA-A*0201-restricted T cell epitopes derived from the EGFR T790M mutation	PLoS One	2013	https://doi.org/10.1371/journal.pone.0078389	dbPepNeo	1
tier2	NA	Renal	Renal Rell Carcinoma	SNV	DHX29	DHX29_V1219E	5	LLKAELVAGL	A02:03	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	CDKN2A	CDKN2A_P114L	2	LLVDLAEEL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	ARHGAP28	ARHGAP28_N601E	4	LMLEYQKILWK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	5	LMTLHGFMMY	A30:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	SNV	SRD5A2	SRD5A2_A295T	7	LPALAFTFFSL	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	RBM12	NA	NA	LPHEAGFCV	B51:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	4	Skin	Melanoma	SNV	MAB21L1	MAB21L1_V321M	9	LRIRDRYVM	B08:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	P4	Liver	Hepatocellular Carcinoma	SNV	C5orf42	C5orf42_I1134K	9	LSETFQLLK	A11:01	PMID:31887370	Heterogeneous immunogenomic features and distinct escape mechanisms in multifocal hepatocellular carcinoma	Journal of hepatology	2020	https://doi.org/10.1016/j.jhep.2019.12.014	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	OR52N5	OR52N5_P294S	2	LSPTLNPIVY	A01:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	LRP3	LRP3_T722S	9	LTAARPSQSVL	A25:01	PMID:32753545	Tumor infiltrating lymphocytes (TIL) therapy in metastatic melanoma: boosting of neoantigen-specific T cell reactivity and long-term follow-up	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2020-000848	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	IQCF2	IQCF2_A66V	9	LVRRTLLHV	C15:02	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	PRKAR2A	PRKAR2A_L186I	3	LYIWFKTACL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	RAB39B	RAB39B_K143R	5	MEAIRLYQF	B18:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	YOD1	YOD1_S9L	9	METLHIIYLEA	B44:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	ARHGAP28	ARHGAP28_N601E	3	MLEYQKILWK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	ARHGAP28	ARHGAP28_N601E	3	MLEYQKILWKV	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	SNV	CD1C	CD1C_NA	1	MPLVILIVL	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	SNV	CD1C	CD1C_NA	1	MPLVILIVLVL	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Lung	Non-Small Cell Lung Cancer	SNV	EGFR	EGFR_T790M	1	MQLMPFGCLL	A02:01	PMID:24223798	EGFR T790M mutation as a possible target for immunotherapy; identification of HLA-A*0201-restricted T cell epitopes derived from the EGFR T790M mutation	PLoS One	2013	https://doi.org/10.1371/journal.pone.0078389	dbPepNeo	1
tier2	ETV085	B cell	Leukemia	SNV	IPO13	IPO13_I267M	1	MSQPDAQRY	B15:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	4	MTLHGFMMY	A30:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	4	MTLHGFMMY	A30:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	IPO8	IPO8_S357P	9	NISEDVIFF	A25:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	NA	Brain	Glioblastoma	SNV	IL22	IL22_V72I	5	NNTDIRLIGEKLFHG	DRB1*01:01	PMID:30906654	Detection of neoantigen-specific T cells following a personalized vaccine in a patient with glioblastoma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2018.1561106	dbPepNeo	1
tier2	19	Renal	Renal Rell Carcinoma	SNV	FAM46D	FAM46D_A140R	2	NRHDCWSLISL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	3737	Bile duct	Bile Duct Cancer	SNV	ERBB2IP	ERBB2IP_E805G	7	NSKEETGHLENGN	DQB1*0601	PMID:24812403	Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer	Science	2014	https://doi.org/10.1126/science.1251102	dbPepNeo	1
tier2	Pt 005	Ovary	Ovarian Cancer	SNV	IL27RA	IL27RA_P594L	11	PILEVEEMEPLPVM	DQA1*05:01/DQB1*02:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	PTPN12	PTPN12_A403G	15	PKPVLHMVSSEQHSG	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	NA	Ovary	Ovarian Cancer	SNV	TMEM161B	TMEM161B_M280L	4	PLFLVLLWV	A02:01	PMID:32660279	Intranodal Administration of Neoantigen Peptide-loaded Dendritic Cell Vaccine Elicits Epitope-specific T Cell Responses and Clinical Effects in a Patient with Chemorefractory Ovarian Cancer with Malignant Ascites	Immunological Investigations	2021	https://doi.org/10.1080/08820139.2020.1778721	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	B4GALNT3	B4GALNT3_M544V	8	PVKNLPQV	B51:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	Pt 003	Ovary	Ovarian Cancer	SNV	SLK	SLK_Q838L	10	QELRELRFLLKEEQ	DRB1*01:02	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	Pt 015	Ovary	Ovarian Cancer	SNV	TRPC4	TRPC4_G577V	9	QSLFWSIFV	A69:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	COA6	COA6_K50N	4	QWINYFDKRRDYLKF	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	EEF1A2	EEF1A2_T142M	9	REHALLAYM	B18:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ETV085	B cell	Leukemia	SNV	FAM157B	FAM157B_L156F	2	RFLHDLHLL	A24:02	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	KADA	Skin	Melanoma	SNV	MYLIP	MYLIP_P8L	2	RLDAVLMEV	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	PDE7B	PDE7B_G113R	1	RMWDFDIFL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	MTRR	MTRR_S216C	14	RTDLVKSELLHIECQ	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	ETV078	B cell	Leukemia	SNV	GPR139	GPR139_A298T	6	RTMAATTLK	A03:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	TRIOBP	TRIOBP_G365L	11	RTSSTQQDNPK	A11:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	CTE-0015	Ovary	Ovarian Cancer	SNV	TP53	TP53_A159V	4	RVRVMAIYK	A11:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	SNV	GLG1	GLG1_L302I	6	RVYKCIFNH	A03:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	SNV	GLG1	GLG1_L302I	6	RVYKCIFNHK	A03:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Mesothelium	Mesothelioma	SNV	ROBO3	ROBO3_P640H	3	SEHSPVSEPV	B49:01	PMID:32002298	Identification of a CD8+ T-cell response to a predicted neoantigen in malignant mesothelioma	Oncoimmunology	2019	https://doi.org/10.1080/2162402x.2019.1684713	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	CCNA1	CCNA1_L426R	10	SEIVPCLSERHKAYL	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	SMG1	SMG1_I3507F	2	SFYNNLVSFASPLVT	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	Pt 019	Ovary	Ovarian Cancer	SNV	NUP214	NUP214_Q60H	4	SGLHIFPTKNLLIQ	DRB1*15:01	PMID:31221207	Efficient identification of neoantigen-specific T-cell responses in advanced human ovarian cancer	Journal for ImmunoTherapy of?Cancer	2019	https://doi.org/10.1186/s40425-019-0629-6	dbPepNeo	1
tier2	CTE-0011	Ovary	Ovarian Cancer	SNV	9-Sep	SEPT9_R289H	7	SILEQMHRK	A11:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	GCN1L1	GCN1L1_P274L	6	SLLRSLENV	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	SOCS6	SOCS6_P134L	9	SLRSHHYSL	B08:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	LATS2	LATS2_G875E	4	SLVETPNYI	A02:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	LATS2	LATS2_G875E	4	SLVETPNYI	A32:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	CTE-0012	Ovary	Ovarian Cancer	SNV	KIR2DS4	KIR2DS4_I7S	1	SMACVGFFL	A02:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	ETV084	B cell	Leukemia	SNV	ASXL3	ASXL3_E1718K	5	SPMEKAISL	B35:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	PCDH8	PCDH8_R1183H	4	SPPHPGRLPDL	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	PRICKLE3	PRICKLE3_G566L	11	SSEDDGFFLGK	A11:01	PMID:32582212	Evaluation of T-Cell Responses Against Shared Melanoma Associated Antigens and Predicted Neoantigens in Cutaneous Melanoma Patients Treated With the CSF-470 Allogeneic Cell Vaccine Plus BCG and GM-CSF	Frontiers in Immunology 	2020	https://doi.org/10.3389/fimmu.2020.01147	dbPepNeo	1
tier2	3	Skin	Melanoma	SNV	FAM190A	FAM190A_V195A	10	SSHYKFSKPALQSQS	DRB1*01:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	NA	Skin	Melanoma	SNV	CGB2	CGB2_P143L	8	SSSKAPLPSL	C16:01	PMID:26359337	Genomic correlates of response to CTLA-4 blockade in metastatic melanoma	Science	2015	https://doi.org/10.1126/science.aad0095	dbPepNeo	1
tier2	ETV084	B cell	Leukemia	SNV	DTX3L	DTX3L_D141H	3	TAHLNCNLF	B35:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	ERG009	B cell	Leukemia	SNV	PLCD3	PLCD3_D314H	3	TLHGFMMYL	A30:01	PMID:31243155	Pediatric patients with acute lymphoblastic leukemia generate abundant and functional neoantigen-specific CD8?+?T cell responses	Science Translational Medicine	2019	https://doi.org/10.1126/scitranslmed.aat8549	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	SLC25A19	SLC25A19_NA	10	TLIAIFPYARL	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	PRKAR2A	PRKAR2A_L186I	6	TQFLYIWFK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	CTE-0014	Ovary	Ovarian Cancer	SNV	USP47	USP47_V170L	5	TSDYLSQSY	A01:01	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	3737	Bile duct	Bile Duct Cancer	SNV	ERBB2IP	ERBB2IP_E805G	13	TSFLSINSKEETGHL	DRB1*04:05	PMID:26516200	Immunogenicity of somatic mutations in human gastrointestinal cancers	Science	2015	https://doi.org/10.1126/Science.aad1253	dbPepNeo	1
tier2	CTE-0010	Ovary	Ovarian Cancer	SNV	DCHS1	DCHS1_P141L	9	VADINDHAL	C03:03	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	NA	Renal	Collecting Duct Carcinoma	SNV	EFCAB13	EFCAB13_K321N	10	VAGCYLKYKNKNSLS	DRB1*12:02	PMID:32439798	Personalized neoantigen-based immunotherapy for advanced collecting duct carcinoma: case report	Journal for ImmunoTherapy of?Cancer	2020	https://doi.org/10.1136/jitc-2019-000217	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	SNV	PCDH11X	PCDH11X_V500I	7	VFTQSFITVSI	A24:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Lung	Lung Cancer	SNV	TP53	TP53_R158L	2	VLAMAIYKQ	A02:01	PMID:32934692	Point mutation screening of tumor neoantigens and peptide-induced specific cytotoxic T lymphocytes using The Cancer Genome Atlas database	Oncology?Letters	2020	https://doi.org/10.3892/ol.2020.11986	dbPepNeo	1
tier2	MEL69	Skin	Melanoma	SNV	MPV17	MPV17_R75G	4	VLDGFIPGT	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	2	Renal	Renal Rell Carcinoma	SNV	NEK10	NEK10_E182Y	11	VLICLRLLMRY	B15:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	ANRU	Skin	Melanoma	SNV	ETV6	ETV6_L340V	1	VLWDYVYQL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	ANRU	Skin	Melanoma	SNV	ETV6	ETV6_L340V	1	VLWDYVYQLL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	ERCC8	ERCC8_A221V	6	VRRASVCLITL	C07:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	RMM-01	Bone	Myeloma	SNV	PRKDC	PRKDC_Q823E	9	VSALSRAAEK	A03:01	PMID:31857430	Mutation-derived Neoantigen-specific T-cell Responses in Multiple Myeloma	Clinical?Cancer?Research	2020	https://doi.org/10.1158/1078-0432.ccr-19-2309	dbPepNeo	1
tier2	CTE-0015	Ovary	Ovarian Cancer	SNV	OR2T3	OR2T3_C132Y	2	VYRPLHYPLL	C07:02	PMID:29545564	Sensitive and frequent identification of high avidity neo-epitope specific CD8?+?T cells in immunotherapy-naive ovarian cancer	Nature communications	2018	https://doi.org/10.1038/s41467-018-03301-0	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	F2RL2	F2RL2_K74T	9	WTGATITVTIK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	POGK	POGK_P46L	3	WVLALFDEV	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	SNV	KCNA10	KCNA10_V538F	10	YFATLITELF	C04:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	MEL66	Skin	Melanoma	SNV	ZDBF2	ZDBF2_S2228L	3	YILKYSVFL	A02:01	PMID:31685621	Immunological ignorance is an enabling feature of the oligo-clonal T cell response to melanoma neoantigens	Proceedings of the National Academy of Sciences of the United States of America	2019	https://doi.org/10.1073/pnas.1906026116	dbPepNeo	1
tier2	NA	Colorectal	Colorectal Cancer	SNV	KRAS	KRAS_G12V	9	YKLVVVGAV	A02:01	PMID:32934692	Point mutation screening of tumor neoantigens and peptide-induced specific cytotoxic T lymphocytes using The Cancer Genome Atlas database	Oncology?Letters	2020	https://doi.org/10.3892/ol.2020.11986	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	SNV	GYS1	GYS1_NA	8	YLCAGAVYF	C04:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	KADA	Skin	Melanoma	SNV	SVIL	SVIL_E2183K	5	YLTDKDFEFA	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	SNV	TEAD2	TEAD2_L2001Q	7	YMMNSVQENF	B44:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	SNV	C20orf27	C20orf27_H374Y	1	YVRVTVQARVM	B07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	Lymph	Lymphomas	RNA splicing	MS4A1	NA	NA	KPLFRRMSSLELVIAGIVEN	DRB1	PMID:25449106	CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes	International Journal Of?Cancer	2015	https://doi.org/10.1002/ijc.29366	NA	0
tier2	NA	Lymph	Lymphomas	RNA splicing	MS4A1	NA	NA	RMSSLELVI	A2	PMID:25449106	CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes	International Journal Of?Cancer	2015	https://doi.org/10.1002/ijc.29366	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	MLMAQEALAFLMAQGAMLAA	HLA-DR	PMID:15067093	Identification of multiple HLA-DR-restricted epitopes of the tumor-associated antigen CAMEL by CD4+ Th1/Th2 lymphocytes	Journal of Immunology	2004	https://doi.org/10.4049/jimmunol.172.8.5095	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	QGAMLAAQERRVPRAAEVPG	HLA-DR3	PMID:15067093	Identification of multiple HLA-DR-restricted epitopes of the tumor-associated antigen CAMEL by CD4+ Th1/Th2 lymphocytes	Journal of Immunology	2004	https://doi.org/10.4049/jimmunol.172.8.5095	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	APRGVRMAVPLLRRMEGAPA	HLA-DR	PMID:15067093	Identification of multiple HLA-DR-restricted epitopes of the tumor-associated antigen CAMEL by CD4+ Th1/Th2 lymphocytes	Journal of Immunology	2004	https://doi.org/10.4049/jimmunol.172.8.5095	NA	0
tier2	NA	Oral	Oral cancer	RNA splicing	Survivin	NA	NA	AYACNTSTL	A24:02	PMID:?19123955	Comparative study on the immunogenicity between an HLA-A24-restricted cytotoxic T cell epitope derived from survivin and that from its splice variant survivin-2B in oral cancer patients	Journal of Translational Medicine	2009	https://doi.org/10.1186/1479-5876-7-1	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	CLSRRPWKRSWSAGSCPGMPHL	HLA-DR7/HLA-DR11/HLA-DR12	PMID:12538712	CD4+?Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame	Journal of Immunology	2003	https://doi.org/10.4049/jimmunol.170.3.1490	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	CAMEL	NA	NA	RTAACFSCTSRCLSRRPWKRSWS	NA	PMID:12538712	CD4+?Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame	Journal of Immunology	2003	https://doi.org/10.4049/jimmunol.170.3.1490	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	GP100	NA	NA	VYFFLPDHL	A24	PMID:9200467	The intronic region of an incompletely spliced gp100 gene transcript encodes an epitope recognized by melanoma-reactive tumor-infiltrating lymphocytes	Journal of Immunology	1997	http://www.jimmunol.org/content/159/1/303	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	GNT-V	NA	NA	VLPDVFIRC	A1	PMID:24073381	High frequency of T cells specific for cryptic epitopes in melanoma patients	Oncoimmunology	2013	https://doi.org/10.4161/onci.25374	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	GNT-V	NA	NA	VLPDVFIRCV	A1	PMID:24073381	High frequency of T cells specific for cryptic epitopes in melanoma patients	Oncoimmunology	2013	https://doi.org/10.4161/onci.25374	NA	0
tier2	NA	Skin	Melanoma	RNA splicing	AIM2	NA	NA	RSDSGQQARY	A1	PMID:24073381	High frequency of T cells specific for cryptic epitopes in melanoma patients	Oncoimmunology	2013	https://doi.org/10.4161/onci.25374	NA	0
tier2	NA	Skin	Melanoma	Non-coding	GnTV	NA	NA	VLPDVFIRCV	A02:01	PMID:8642259	A peptide recognized by human cytolytic T lymphocytes on HLA-A2 melanomas is encoded by an intron sequence of the N-acetylglucosaminyltransferase V gene	Journal of experimental medicine	1996	https://doi.org/10.1084/jem.183.3.1173	dbPepNeo	1
tier2	P006	Colorectal	Colorectal Cancer	INDEL	FGF11	FGF11_G19fs	NA	AARVSTSRRIPTEASRAPQRIPAPSPTST	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	TAF1C	NA	NA	AEGASVPRLAGPPPV QDRLPPCISSAGA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	2	Skin	Melanoma	INDEL	ADM2	ADM2_NeoORF	NA	AGPKPSSSEWAVCWAP	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	EGFR	EGFR_747_751del	NA	AIKESPKANK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Lung Cancer	INDEL	EGFR	EGFR_E746_A750del 	NA	AIKTSPKANK	A11:01	PMID:32793190	Identification of clonal neoantigens derived from driver mutations in an EGFR mutated lung cancer patient benefitting from anti-PD-1	Frontiers in Immunology 	2020	https://www.frontiersin.org/articles/10.3389/fimmu.2020.01366/full	dbPepNeo	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	EGFR	EGFR_746_750del	NA	AIKTSPKANK	A03:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	INDEL	CMAS	CMAS_773_775del	NA	AKRHLIEMGTCRVEKWHTTKCELNIVWIKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P004	Lung	Lung Cancer	INDEL	REC8	NA	NA	AYLISECAFPAFLLSELLFKQKTSCFYYKKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	SH3PXD2A	SH3PXD2A_R119Gfs*38	NA	DEVFGSSRL	B40:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	5	Skin	Melanoma	INDEL	MUC5B	MUC5B_NeoORF	NA	DKGHQFHVHPLLHSG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	CHD4	CHD4_302_303del	NA	DYTPGKKKKKLGPKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	1	Skin	Melanoma	INDEL	CASP5	CASP5_NeoORF	NA	EEFLRLCKKIMMRSIQ	DRB1*04:04	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	dbPepNeo	1
tier2	1	Skin	Melanoma	INDEL	CASP5	CASP5_NeoORF	NA	EEFLRLCKKIMMRSIQ	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P004	Lung	Lung Cancer	INDEL	SLC4A2	NA	NA	EPRWRRRRRRRWRWPVALQGVTTGVPRG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	SALL2	SALL2_17_18del	NA	ERRGVSRSFPGRCHRYSGWGRRGPDLG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	ACVR2A	NA	NA	FEDRYVCHGISPMGTGFSLYC	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Colorectal	Colorectal, Gastric, And Endometrial Carcinoma	INDEL	CASP-5	NA	NA	FLIIWQNTM	A02:01	PMID:15563124	Immunogenic peptides generated by frameshift mutations in DNA mismatch repair-deficient cancer cells	Cancer Immunity	2004	https://cancerimmunolres.aacrjournals.org/content/canimmarch/4/1/14	CAPD	1
tier2	NA	Head and Neck	Head And Neck Squamous Cell Carcinoma	INDEL	CASP-8	NA	NA	FPSDSWCYF	B35:03	PMID:9271594	A CASP-8 mutation recognized by cytolytic T lymphocytes on a human head and neck carcinoma.	Journal of Experimental Medicine	1997	https://doi.org/10.1084/jem.186.5.785	CAPD	1
tier2	patient 12	Lung	Lung Cancer	INDEL	SIDT2	SIDT2_IA664del	NA	FSIIHITLL	A02:01	PMID:33473101	Personalized neoantigen pulsed dendritic cell vaccine for advanced lung cancer	Signal Transduction and Targeted Therapy	2021	https://doi.org/10.1038/s41392-020-00448-5	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	PPP1R9B	PPP1R9B_S659fs	NA	GARGGDPGRGYGPRGPGEWQHR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	PPP1R9B	PPP1R9B_S659fs	NA	GEWQHRGNCSQPRARGAK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	6	Skin	Melanoma	INDEL	TNS1	TNS1_NeoORF	NA	GLTRISIQRAQPLPP	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P013	Skin	Melanoma	INDEL	ABCC10	ABCC10_140_140del	NA	GQEPLSHPALCSGASRWGCAG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P004	Lung	Lung Cancer	INDEL	SLC4A2	NA	NA	GVPRGAPCPKPSLGTAATTFRRGGASGA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P001	Skin	Melanoma	INDEL	ATP2A1	ATP2A1_D380fs	NA	HQWLALLPLHGNRGLCGCSHR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P020	Colorectal	Colorectal Cancer	INDEL	ARFGEF3	NA	NA	HSVTDTVDYSLAMPGSK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	INDEL	MUC5B	MUC5B_NeoORF	NA	HSYQLYTHPLLHPWD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Lung	Lung Cancer	INDEL	EGFR	EGFR_E746_A750del 	NA	IPVAIKTSPK	A11:01	PMID:32793190	Identification of clonal neoantigens derived from driver mutations in an EGFR mutated lung cancer patient benefitting from anti-PD-1	Frontiers in Immunology 	2020	https://www.frontiersin.org/articles/10.3389/fimmu.2020.01366/full	dbPepNeo	1
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	EGFR	EGFR_E746_A750del	NA	IPVAIKTSPK	A03:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	6	Skin	Melanoma	INDEL	TNS1	TNS1_P789fs	NA	ISIQRAQPLPPCLPSF	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	INDEL	LYSMD3	LYSMD3_P432fs	NA	IVKILSHLLLNRKQQLDSLASIL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	INDEL	RALGAPB	RALGAPB_17_18del	NA	KHLPQIFFRACVESAVWWMHSKKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P020	Colorectal	Colorectal Cancer	INDEL	CAMK2D	CAMK2D_P407fs	NA	KKADASHCIQQILEAATLPSDGRGPSGPEA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P006	Colorectal	Colorectal Cancer	INDEL	SETD1B	SETD1B_533_534del	NA	KKKDTELQMEGSPISSSSQLSPLAPFGTNSQ	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	INDEL	MARCKS	MARCKS_A6fs	NA	KKKEALFLQEVFQAERLLLQEEQEGGWRRR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P017	Skin	Melanoma	INDEL	AKAP13	AKAP13_F69delinsFFFF	NA	KKKKKKLFFLMGLLFYGHHIQVFHRGCVNL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	SALL2	SALL2_17_18del	NA	KKKKKPLEYPPDLGRATGAAAAADPSDADD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	USP48	USP48_P1461H	NA	KKKKNEDILCPHAVFFFFQIYFFKLR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P019	Stomach	Gastric Carcinoma	INDEL	MPZL2	NA	NA	KKKSILLWKLQFDDNGTGEEPT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P012	Breast	Breast Cancer	INDEL	PRKD3	PRKD3_I289fs	15	KKSGTFPFNEDEDINPKCCIYVPTKSMERNFW	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P017	Skin	Melanoma	INDEL	AKAP13	AKAP13_F69delinsFFFF	NA	KKYGHHIQVFHRGCVNLRITVGKWPQWHLF	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P021	Lung	Lung Cancer	INDEL	DYNC1I2	DYNC1I2_S36fs	NA	KRKEEERKKKRNRPEEGSC	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4	Skin	Melanoma	INDEL	DHX40a	DHX40a_S754fs	NA	KRRWSALVI	B27:02	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	ACVR2A	NA	NA	KSAGDTHGPGWYPEVHGSRGIRGCYKLPK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P013	Skin	Melanoma	INDEL	PQBP1	PQBP1_212_212del	NA	KVDRERARQGTGSGPRV	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P013	Skin	Melanoma	INDEL	SMAP2	SMAP2_I717fs	NA	KWKRGSEPVPEKKIG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	6	Skin	Melanoma	INDEL	RALGAPB	RALGAPB_NeoORF	NA	LFRIKFKEPL	B08:01	PMID:28678778	An immunogenic personal neoantigen vaccine for patients with Melanoma	Nature	2017	https://doi.org/10.1038/Nature22991	NeoPeptide	1
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	INDEL	ACACB	ACACB_D133fs	NA	LHLVKRGAGTQEAGPAQRLYRGFSR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Skin	Peritoneal Mesothelioma	INDEL	BAP1	BAP1_V523fs	NA	LPHLQGAF	B35:42	PMID:27187383	A Tumor-Specific Neo-Antigen Caused by a Frameshift Mutation in BAP1 Is a Potential Personalized Biomarker in Malignant Peritoneal Mesothelioma	International Journal of Molecular Sciences	2016	https://doi.org/10.3390/ijms17050739	NA	0
tier2	P004	Lung	Lung Cancer	INDEL	SLC4A2	NA	NA	LPLHHCPTRRRLLGPPKGPRLEPRWRRRRRR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	INDEL	SH2D4A	SH2D4A_543_543del	NA	MPLQTPTASWAWTSYSMPPWRIWWNITRR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	NOTCH1	NOTCH1_HMY246-248fs	NA	NSTGSCATSWTTASGVGPGATS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	EGFR	EGFR_13_13del	NA	PEGEKVKIPVAIKESPKANKEILD	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	SALL2	SALL2_17_18del	NA	PERRGVSRAFPGRCHRYSGWGRRGPDLG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P022	Colorectal	Colorectal Cancer	INDEL	CPE	CPE_L23fs	NA	PRAARGARVRVAAVHRHQQDLH	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	INDEL	TMEM176B	TMEM176B_548_548del	NA	PTTGYRWMRRSQEKEECRAYMQMLRKLF	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	INDEL	MUC5B	MUC5B_NeoORF	NA	QLYTHPLLHPWDHRD	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P022	Colorectal	Colorectal Cancer	INDEL	CPE	CPE_L23fs	NA	QQDLHGGAQLRGPGAPGHRAVRQPWRP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	4289	Kidney	Rectal Cancer	INDEL	APC	APC_A1474fs	NA	QVLPDADTLLHFARKVLQMDFLVHPA	NA	PMID:33016924	mRNA vaccine induced neoantigen-specific T cell immunity in patients with gastrointestinal cancer	Journal of Clinical Investigation 	2020	https://doi.org/10.1172/JCI134915.	NA	0
tier2	P006	Colorectal	Colorectal Cancer	INDEL	FGF11	FGF11_G19fs	NA	REVREPGAAGRCRRSGACVPAAPSPFARSSSS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	INDEL	SH2D4A	SH2D4A_543_543del	NA	RIWWNITRRNPSLPWGR SIPVVSRTSC	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	GNRH2	GNRH2_M7delinsGM	NA	RKRHLARTLLTAAREPRPAPPRHPPIKCEVLR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	SH3PXD2A	SH3PXD2A_R119Gfs*38	NA	RLDPRMSTLQK	A11:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	6	Skin	Melanoma	INDEL	PISD	PISD_R117fs	11	RLQPVHLDVWGEHERG	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	NA	Colorectal	Colorectal Cancer	INDEL	TGFBR2	NA	NA	RLSSCVPVA	A2.1	PMID:11391614	Frameshift peptide-derived T-cell epitopes: a source of novel tumor-specific antigens.	International Journal of Cancer	2001	https://doi.org/10.1002/ijc.1298	CAPD	1
tier2	P003	Adrenal	AdreNAl Sebaceous Adenocarcinoma	INDEL	LSM11	LSM11_L72fs	NA	RMPLHEGSPLGELSSLYP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	SALL2	SALL2_17_18del	NA	RRGPDLGQSQAGSNPITSRIDPCTPSSSTTP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P019	Stomach	Gastric Carcinoma	INDEL	BRD4	NA	NA	RRRQEQQQQRQEQKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P006	Colorectal	Colorectal Cancer	INDEL	FGF11	FGF11_G19fs	NA	RSLSSKASSPNCSAARVSTSRRIPTEAS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P007	Lung	Lung Cancer	INDEL	PPP1R9B	PPP1R9B_E77Q	NA	SAAREGGGQWPGPGRG	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	5	Skin	Melanoma	INDEL	MUC5B	MUC5B_NeoORF	NA	SHQIHSYQLYTHPLL	NA	PMID:33479501	Personal neoantigen vaccines induce persistent memory T cell responses and epitope spreading in patients with Melanoma	Nature Method	2021	https://doi.org/10.1038/s41591-020-01206-4	NA	0
tier2	P015	Biliary	Biliary Tract Cancer	INDEL	SH2D4A	SH2D4A_543_543del	NA	SIPVVSRTSCLTTWSCLSDSLHQGHPTASK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P002	Ovary	Ovarian Cancer	INDEL	HNF1B	HNF1B_622_623del	NA	SLQQELLSALLSSGVRCWFRPWRS	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P004	Lung	Lung Cancer	INDEL	REC8	NA	NA	SLVSPQPPQDGCPGLLPAPGALSATKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Colorectal	Colorectal Cancer	INDEL	OGT	NA	NA	SLYKFSPFPL	A02:01	PMID:14601650	Identification of an HLA-A0201-restricted CTL epitope generated by a tumor-specific frameshift mutation in a coding microsatellite of the OGT gene.	Journal of Clinical Immunology	2003	https://doi.org/10.1023/a:1025329819121	CAPD	1
tier2	1238	Lung	Non-Small-Cell Lung Cancer	INDEL	HER2	HER2_809_810insYVMA	NA	SPKANKEILDEAYVMAYVMAGVGSPYVSRLLG	DRB1*05:01/05:02	PMID:31043415	Endogenous CD4+ T Cells Recognize Neoantigens in Lung Cancer Patients, Including Recurrent Oncogenic KRAS and ERBB2 (Her2) Driver Mutations	Cancer Immunology Research	2019	https://doi.org/10.1158/2326-6066.CIR-18-0402	NeoPeptide	1
tier2	P008	Pancreas	Pancreatic Carcinoma	INDEL	MARCKS	MARCKS_A6fs	NA	SPSNETPKKKKEALFLQEVFQAERLL	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	ACVR2A	NA	NA	SRGIRGCYKLPKGCIFEDRYVCHGISPMGT	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	NOTCH1	NA	NA	TCLCLGPFTAPNASSRPAAP	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P009	Pancreas	Pancreatic Carcinoma	INDEL	SALL2	SALL2_17_18del	NA	TPSSSTTPSAPRGRQWPLEYPPDLGR	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P022	Colorectal	Colorectal Cancer	INDEL	APC	APC_I1304fs	NA	TTQEADSANTLQKQK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	PIK3R1	NA	NA	VKEDNIEAVGKKLHEI	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	EGFR	EGFR_746_750del	NA	VKIPVAIKTSPKANKEI	DRB1*13:01	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	NA	Lung	Non-Small-Cell Lung Cancer	INDEL	EGFR	EGFR_746_750del	NA	VKIPVAIKTSPKANKEI	DRB1*16:02	PMID:34244308	Neoantigen vaccination induces clinical and immunologic responses in non- small cell lung cancer patients harboring EGFR mutations	Journal for Immunotherapy of Cancer	2021	https://jitc.bmj.com/lookup/pmidlookupview=long&pmid=34244308	NA	0
tier2	P018	Parotid	Parotid Carcinoma	INDEL	NOTCH1	NOTCH1_HMY246-248fs	NA	VSPHPRAPSTVACAPPNSTGSCA	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	P008	Pancreas	Pancreatic Carcinoma	INDEL	CYHR1	NA	NA	YGMWGGGDAGCGRPPEPAGGGQAAAATEGGKK	NA	PMID:32439700	A Pan-cancer Clinical Study of Personalized Neoantigen Vaccine Monotherapy in Treating Patients with Various Types of Advanced Solid Tumors	Clinical Cancer Research	2020	https://aacrjournals.org/clincancerres/article-lookup/doi/10.1158/1078-0432.CCR-19-2881	NA	0
tier2	NA	B cell	Leukemia	INDEL	NPM1	NA	NA	CLAVEEVSL	A02:01	PMID:30640174	Mutated nucleophosmin 1 as immunotherapy target in acute myeloid leukemia	The Journal of Clinical Investigation	2019	https://doi.org/10.1172/jci97482	dbPepNeo	1
tier2	NA	B cell	Leukemia	INDEL	NPM2	NA	NA	CLAVEEVSL	A02:02	PMID:30640174	Mutated nucleophosmin 1 as immunotherapy target in acute myeloid leukemia	The Journal of Clinical Investigation	2019	https://doi.org/10.1172/jci97482	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	INDEL	RBM5	NA	NA	FRYYRVSILL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	INDEL	MBD5	NA	NA	ILPKVLILI	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	INDEL	COL14A1	NA	NA	KIISFYTALL	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	INDEL	EGFL6	NA	NA	KMILTGILLI	A24:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	12	Renal	Renal Rell Carcinoma	INDEL	ZNF720	NA	NA	KSDIGWIWELW	A01:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	INDEL	IQCD	NA	NA	LLHASFVTL	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	INDEL	IQCD	NA	NA	LLHASFVTL	B15:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	4	Renal	Renal Rell Carcinoma	INDEL	IQCD	NA	NA	LLHASFVTLGK	A11:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	INDEL	EGFL6	NA	NA	MILTGILLIEI	A02:01	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	17	Renal	Renal Rell Carcinoma	INDEL	TNNT2	NA	NA	RFWLRGGRCW	A24:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	16	Renal	Renal Rell Carcinoma	INDEL	RBM5	NA	NA	RYYRVSILL	C07:02	PMID:32226429	Tumor-Infiltrating T Cells From Clear Cell Renal Cell Carcinoma Patients Recognize Neoepitopes Derived From Point and Frameshift Mutations	Frontiers in Immunology	2020	https://doi.org/10.3389/fimmu.2020.00373	dbPepNeo	1
tier2	NA	B cell	Leukemia	Fusion	BCR,ABL	BCR-ABL_E255K	1	KVYEGVWKK	A03:01	PMID:22912393	Mutated BCR-ABL generates immunogenic T-cell epitopes in CML patients	Clinical?Cancer?Research	2012	https://doi.org/10.1158/1078-0432.ccr-12-1182	dbPepNeo	1
tier2	NA	B cell	Chronic Myeloid Leukemia	Fusion	BCR,ABL	BCR-ABL	NA	ATGFKQSSKALQRPVAS	DR9	PMID:1245474	Leukemia-associated fusion proteins, dek-can and bcr-abl, represent immunogenic HLA-DR-restricted epitopes recognized by fusion peptide-specific CD4+ T lymphocytes.	Leukemia	2002	https://doi.org/10.1038/sj.leu.2402742	CAPD	1
tier2	NA	B cell	Chronic Myeloid Leukemia	Fusion	BCR,ABL	BCR-ABL	NA	ATGFKQSSKALQRPVAS	DRB1*04:01	PMID:8896419	Recognition of BCR-ABL positive leukemic blasts by human CD4+ T cells elicited by primary in vitro immunization with a BCR-ABL breakpoint peptide.	Blood	1996	https://linkinghub.elsevier.com/retrieve/pii/S0006-4971(20)61367-2	CAPD	1
tier2	NA	Head and Neck	Head And Neck Squamous Cell Carcinoma	Fusion	DEK,AFF2	DEK-AFF2	NA	DKESEEEVS	C04:01	PMID:31011208	Immunogenic neoantigens derived from gene fusions stimulate T cell responses	Nature Medicine	2019	https://doi.org/10.1038/s41591-019-0434-2	dbPepNeo	1
tier2	NA	B cell	Chronic Myeloid Leukemia	Fusion	BCR,ABL	BCR-ABL	NA	GFKQSSKAL	B8	PMID:9593785	Cytotoxic T cell response against the chimeric p210 BCR-ABL protein in patients with chronic myelogenous leukemia	Journal of Clinical Investigation	1998	https://doi.org/10.1172/jci488	CAPD	1
tier2	NA	B cell	Acute Lymphoblastic Leukemia	Fusion	ETV6,AML1	ETV6-AML1	NA	IGRIAECILGMNPSR	DP5	PMID:10488742	Augmentation of immune response by altered peptide ligands of the antigenic peptide in a human CD4+ T-cell clone reacting to TEL/AML1 fusion protein	Tissue Antigens	1999	https://doi.org/10.1034/j.1399-0039.1999.540206.x	CAPD	1
tier2	NA	B cell	Acute Lymphoblastic Leukemia	Fusion	ETV6,AML1	ETV6-AML1	NA	IGRIAECILGMNPSR	DP17	PMID:10488742	Augmentation of immune response by altered peptide ligands of the antigenic peptide in a human CD4+ T-cell clone reacting to TEL/AML1 fusion protein	Tissue Antigens	1999	https://doi.org/10.1034/j.1399-0039.1999.540206.x	CAPD	1
tier2	NA	Gland	Adenoid Cystic Carcinoma	Fusion	NFIB,MYB	NFIB-MYB	NA	MMYSPICLTQT	A02:01	PMID:31011208	Immunogenic neoantigens derived from gene fusions stimulate T cell responses	Nature Medicine	2019	https://doi.org/10.1038/s41591-019-0434-2	dbPepNeo	1
tier2	NA	B cell	Promyelocytic Leukemia	Fusion	PML,RARalpha	PML-RARalpha	NA	NSNHVASGAGEAAIETQSSSSEEIV	DR11	PMID:8095167	Human CD4 lymphocytes specifically recognize a peptide representing the fusion region of the hybrid protein pml/RAR alpha present in acute promyelocytic leukemia cells.	Blood	1993	https://doi.org/10.1182/blood.V81.5.1369.1369	CAPD	1
tier2	NA	Skin	Melanoma	Fusion	LDLR,FUT	LDLR-FUT	NA	PVTWRRAPA	DRB1*01:01	PMID:10330445	Identification of a novel major histocompatibility complex class II-restricted tumor antigen resulting from a chromosomal rearrangement recognized by CD4(+) T cells	Journal of Experimental Medicine	1999	https://doi.org/10.1084/jem.189.10.1659	CAPD	1
tier2	NA	Gland	Adenoid Cystic Carcinoma	Fusion	MYB,NFIB	MYB-NFIB	NA	QFIDSSWYL	A02:01	PMID:31011208	Immunogenic neoantigens derived from gene fusions stimulate T cell responses	Nature Medicine	2019	https://doi.org/10.1038/s41591-019-0434-2	dbPepNeo	1
tier2	NA	Sarcoma	Sarcoma	Fusion	SYT,SSX1	SYT-SSX1	NA	QRPYGYDQIM	B7	PMID:11559563	Antigenicity of fusion proteins from sarcoma-associated chromosomal translocations	Cancer Research	2001	http://cancerres.aacrjournals.org/cgi/pmidlookupview=long&pmid=11559563	CAPD	1
tier2	NA	B cell	Acute Myeloid Leukemia	Fusion	CBFB,MYH11	CBFB-MYH11	NA	REEMEVHEL	B40:01	PMID:32831296	CBFB-MYH11 fusion neoantigen enables T cell recognition and killing of acute myeloid leukemia	Journal of Clinical Investigation	2020	https://doi.org/10.1172/JCI137723.	dbPepNeo	1
tier2	NA	B cell	Acute Lymphoblastic Leukemia	Fusion	ETV6,AML1	ETV6-AML1	NA	RIAECILGM	A2	PMID:9664088	Cytotoxic T cell response against the chimeric ETV6-AML1 protein in childhood acute lymphoblastic leukemia	Journal of Clinical Investigation	1998	https://doi.org/10.1172/jci3126	CAPD	1
tier2	NA	Gland	Adenoid Cystic Carcinoma	Fusion	MYB,NFIB	MYB-NFIB	NA	SLASPLQPT	A02:01	PMID:31011208	Immunogenic neoantigens derived from gene fusions stimulate T cell responses	Nature Medicine	2019	https://doi.org/10.1038/s41591-019-0434-2	dbPepNeo	1
tier2	NA	Striated Muscle Cell	Alveolar Rhabdomyosarcoma	Fusion	PAX,FKHR	PAX-FKHR	NA	SPANSIRHNL	B07:02	PMID:16452243	Identification and epitope enhancement of a PAX-FKHR fusion protein breakpoint epitope in alveolar rhabdomyosarcoma cells created by a tumorigenic chromosomal translocation inducing CTL capable of lysing human tumors	Cancer?Research	2006	https://doi.org/10.1158/0008-5472.can-05-2549	dbPepNeo	1
tier2	NA	Striated Muscle Cell	Alveolar Rhabdomyosarcoma	Fusion	PAX,FKHR	PAX-FKHR	NA	SPQNSIRHNL	B07:02	PMID:16452243	Identification and epitope enhancement of a PAX-FKHR fusion protein breakpoint epitope in alveolar rhabdomyosarcoma cells created by a tumorigenic chromosomal translocation inducing CTL capable of lysing human tumors	Cancer?Research	2006	https://doi.org/10.1158/0008-5472.can-05-2549	dbPepNeo	1
tier2	NA	B cell	Chronic Myeloid Leukemia	Fusion	BCR,ABL	BCR-ABL	NA	SSKALQRPV	A2	PMID:9593785	Cytotoxic T cell response against the chimeric p210 BCR-ABL protein in patients with chronic myelogenous leukemia	Journal of Clinical Investigation	1998	https://doi.org/10.1172/jci488	CAPD	1
tier2	NA	B cell	Myeloid Leukemia	Fusion	dek,can	dek-can	NA	TMKQICKKEIRRLHQY	DR53	PMID:1245474	Leukemia-associated fusion proteins, dek-can and bcr-abl, represent immunogenic HLA-DR-restricted epitopes recognized by fusion peptide-specific CD4+ T lymphocytes.	Leukemia	2002	https://doi.org/10.1038/sj.leu.2402742	CAPD	1
tier2	NA	Skin	Melanoma	Fusion	LDLR,FUT	LDLR-FUT	NA	WRRAPAPGA	DRB1*01:01	PMID:10330445	Identification of a novel major histocompatibility complex class II-restricted tumor antigen resulting from a chromosomal rearrangement recognized by CD4(+) T cells	Journal of Experimental Medicine	1999	https://doi.org/10.1084/jem.189.10.1659	CAPD	1
tier3	NA	B cell	B721.221 Cell Line	SNV	GRSF1	GRSF1_S95P	7	AAAASYPAL	C17:01	PMID:31844524	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_G23A	2	AAEYGAEAL	C08:01	PMID:31844499	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PTH2	PTH2_R76S	8	AAFRERASL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	C1orf198	C1orf198_A14V	9	AAIAASRSV	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SMARCC1	SMARCC1_E721D	8	AAKAALEDF	C16:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	C1orf198	C1orf198_A14V	6	AASRSVVM	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PMS2	PMS2_Q100R	5	ADLTRVETF	B37:01	PMID:31844423	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EIF5	EIF5_M275I	11	AEAERLDVKAI	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Colorectal Cancer	SNV	EIF3B	EIF3B_S64P	7	AEAGPEPEV	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	IDUA	IDUA_H33Q	8	AEAPHLVQV	B37:01	PMID:31844424	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	IDUA	IDUA_H33Q	8	AEAPHLVQV	B40:02	PMID:31844429	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	IDUA	IDUA_H33Q	8	AEAPHLVQV	B45:01	PMID:31844441	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	IDUA	IDUA_H33Q	8	AEAPHLVQV	B49:01	PMID:31844447	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	IDUA	IDUA_H33Q	8	AEAPHLVQVDA	B45:01	PMID:31844445	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TIAM1	TIAM1_Y283F	7	AEETPPFSNY	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PNPLA7	PNPLA7_Q1139A	4	AEIATRLA	B49:01	PMID:31844446	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EIF5	EIF5_M275I	9	AERLDVKAI	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ALB	ALB_K375E	2	AETYETTLEK	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PARP14	PARP14_P1095A	1	AEWRNGSTSSL	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Colorectal Cancer	SNV	RBM15	RBM15_A356S	6	AGAGASPFREVDE	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	SDHD	SDHD_P142L	8	AILLPQPLK	A11:01	PMID:31844327	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PMS2	PMS2_M30V	8	AKVGTRLVF	B15:03	PMID:31844408	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	WASHC1	WASHC1_G112E	7	AKYPAPERL	B15:03	PMID:31844409	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	BBS5	BBS5_Q151V	7	ALIQNKVL	B08:01	PMID:31844401	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CACNA1I	CACNA1I_R464L		ALQSRLQAL	A02:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_A83E	4	ALSELSDLHA	A02:02	PMID:31844297	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_A83E	4	ALSELSDLHAHKL	A02:02	PMID:31844301	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	YIPF2	YIPF2_P310L	7	ALSPTLLQSL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Skin	Melanoma	SNV	AGPS	AGPS_P533L	2	ALWDRVVDL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	SHCBP1	SHCBP1_M21T	7	AMAPERTGW	A32:01	PMID:31844349	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	SHCBP1	SHCBP1_M21T	7	AMAPERTGW	B13:01	PMID:31844402	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_K145R	7	ANALAHRY	C02:02	PMID:31844475	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987433	LOC107987433_A634G	6	APAAAGAAL	B07:02	PMID:31844395	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987433	LOC107987433_A634G	6	APAAAGAAL	B07:04	PMID:31844398	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987433	LOC107987433_A634G	6	APAAAGAAL	B42:01	PMID:31844437	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RANBP9	RANBP9_H135L	5	APFPLGDSAL	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	RPS2	RPS2_R200G	3	APGGTGIVSA	B07:02	PMID:31844396	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HMGXB3	HMGXB3_A322V	8	APKKPTGVDL	B07:02	PMID:31844397	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HMGXB3	HMGXB3_A322V	8	APKKPTGVDL	B07:04	PMID:31844399	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HMGXB3	HMGXB3_A322V	8	APKKPTGVDL	B42:01	PMID:31844440	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SHC3	SHC3_E376D	7	AQFAGKDQTY	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	NCOA7	NCOA7_N73V	8	ARTSGGYVKL	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TBL3	TBL3_I545V	7	ASADGTVKLW	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OSBP2	OSBP2_Y677H	6	ASGNHHVW	C16:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	9	ASLDKFLANV	A02:06	PMID:31844317	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	9	ASLDKFLANV	A02:07	PMID:31844323	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	9	ASLDKFLANV	A68:02	PMID:31844385	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	9	ASLDKFLANV	C15:02	PMID:31844517	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CYP2A7	CYP2A7_C14S	2	ASLTVMVL	C07:04	PMID:31844498	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_G1145S	2	ASPAVLEL	B51:01	PMID:31844451	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_G1145S	2	ASPAVLEL	B52:01	PMID:31844454	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Skin	Melanoma	SNV	MAP3K9	MAP3K9_E689K	10	ASWVVPIDIK	A03:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	MAP3K9	MAP3K9_E689K	10	ASWVVPIDIK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	COL6A3	COL6A3_P2142Q	6	ATAAKQVAAKP	A02:05	PMID:31844315	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	MKLN1	MKLN1_D521V	4	ATIVPELNEI	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF213	RNF213_D2271V	9	ATPSLHTSV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	12	AVHASLDKFLANV	A68:02	PMID:31844390	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	IRF2BPL	IRF2BPL_M413L	7	AVSKPGLDYEL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ARL6	ARL6_L146F	10	AVTSVKVSQF	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF216	RNF216_M45V	7	DEERIPVL	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ADGRA3	ADGRA3_C734F	9	DENITTIQF	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF213	RNF213_D2271V	11	DFATPSLHTSV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	UBXN6	UBXN6_S427F	2	DFILKPEL	B08:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	FGA	FGA_A29T	4	DFLTEGGGV	A32:01	PMID:31844350	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12D	7	DGVGKSAL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPRS	EPRS_M277I	7	DHFETIIKY	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PTPRC	PTPRC_L1204I	9	DIFQVVKAI	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SPECC1L	SPECC1L_I771V	10	DIKSEAQEEV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPS8	EPS8_Q64E	4	DISEYRVEHL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	TXNL4A	TXNL4A_N70S	9	DITEVPDFSK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	3	DLAGGTFDV	B27:05	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	3	DLAGGTFDVS	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-B	HLA-B_T162M	2	DMAAQITQR	A33:01	PMID:31844354	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-B	HLA-B_T162M	2	DMAAQITQR	A34:01	PMID:31844361	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	WARS	WARS_D148H	7	DMNQVLHAY	C07:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CLTC	CLTC_S989L	6	DPEEVLVTV	B51:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	TUBB8B	TUBB8B_F51L	7	DRIINTLSI	B15:01	PMID:31844405	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OSER1	OSER1_S119N	7	DSPDGSNGL	C01:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	FCHO2	FCHO2_L543S	3	DTSPVAVAL	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CFL2	CFL2_D66Y	5	DTVEYPYTSF	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EIF5	EIF5_M275I	5	DVKAIGPLV	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKRD20A4	ANKRD20A4_M646R	8	DVSVQVER	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_R303P	5	EAAPPFRGQVLF	A68:02	PMID:31844388	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_H172R	4	EAARVAEQLRA	B54:01	PMID:31844467	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CRYBG1	CRYBG1_E1196A	2	EAAYIGSMR	A33:03	PMID:31844357	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CRYBG1	CRYBG1_E1196A	2	EAAYIGSMR	A34:01	PMID:31844362	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CRYBG1	CRYBG1_E1196A	2	EAAYIGSMR	A34:02	PMID:31844367	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CRYBG1	CRYBG1_E1196A	2	EAAYIGSMR	A66:01	PMID:31844372	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CRYBG1	CRYBG1_E1196A	2	EAAYIGSMR	A68:01	PMID:31844379	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TET3	TET3_G238V	8	EAGNNSRVPR	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	ADM	ADM_T162A	7	EAGPGRALV	B49:01	PMID:31844448	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GCNT2	GCNT2_P94L	6	EEADFLLAY	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	TMEM57	TMEM57_R490W	7	EEATAAWAV	B18:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	DNAH7	DNAH7_W748I	7	EEEAFGILP	B45:01	PMID:31844442	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Colorectal	Hct 116 Cell Line	SNV	UQCRB	UQCRB_N88K	4	EEEKFYLEP	B45:01	PMID:25576301	Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation	Molecular & Cellular Proteomics	2015	https://doi.org/10.1074/mcp.m114.042812	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Hct 116 Cell Line	SNV	BCL2L13	BCL2L13_I216V	7	EEEYPGVTA	B45:01	PMID:25576301	Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation	Molecular & Cellular Proteomics	2015	https://doi.org/10.1074/mcp.m114.042812	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Colorectal Cancer	SNV	GAA	GAA_R223H	9	EEPFGVIVH	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	Colorectal	Hct 116 Cell Line	SNV	RBBP7	RBBP7_N17D	6	EERVIDEEY	B18:01	PMID:25576301	Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation	Molecular & Cellular Proteomics	2015	https://doi.org/10.1074/mcp.m114.042812	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	AGMAT	AGMAT_G105L	7	EESVMLLTV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TIAM1	TIAM1_Y283F	6	EETPPFSNY	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPB41L3	EPB41L3_S495L	7	EEVTPILAI	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PIGN	PIGN_W83L	4	EGSLGISHTR	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CRELD1	CRELD1_Q347H	2	EHIPESAGF	B38:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KATNAL1	KATNAL1_D407Y	10	ELDPDIQLEY	A01:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PQLC1	PQLC1_R109C	7	ELNARRCSF	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	CTNS	CTNS_P80L	10	ELPDEVVVPL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	C5orf42	C5orf42_I1908L	6	EMDMHLSDY	A01:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ADGRA3	ADGRA3_C734F	8	ENITTIQFY	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OXSM	OXSM_K109T	7	EQNFVSTSDIK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C01:02	PMID:31844474	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C03:03	PMID:31844480	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C04:01	PMID:31844490	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C05:01	PMID:31844494	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C07:01	PMID:31844495	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C12:03	PMID:31844507	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	5	ESLIACKA	C17:01	PMID:31844523	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ACTG1	ACTG1_G366S	3	ESSPSIVHR	A33:03	PMID:31844358	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ACTG1	ACTG1_G366S	3	ESSPSIVHR	A66:01	PMID:31844373	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NUP153	NUP153_P778L	3	ETLKPGTCVKR	A68:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TIAM1	TIAM1_Y283F	5	ETPPFSNYNTL	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Skin	Melanoma	SNV	GABPA	GABPA_E161K	4	ETSKQVTRW	A25:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	GABPA	GABPA_E161K	4	ETSKQVTRW	A25:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TTK	TTK_G804E	1	ETTEEMKYVL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ALB	ALB_K375E	1	ETYETTLEK	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZFYVE9	ZFYVE9_K845T	7	EVADAATLTM	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Skin	Melanoma	SNV	IFRD2	IFRD2_H446Y	10	EVLGSGMHHY	A26:01	PMID:27600516	Mass spectrometric analysis of the HLA class I peptidome of melanoma cell lines as a promising tool for the identification of putative tumor-associated HLA epitopes	Cancer Immunol Immunother	2016	https://doi.org/10.1007/s00262-016-1897-3	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	FAM185A	FAM185A_G60A	8	EVPPPGPAR	A34:01	PMID:31844363	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_A38V	2	EVRPVETLR	A33:01	PMID:31844355	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_A38V	2	EVRPVETLR	A33:03	PMID:31844359	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	BTN2A2	BTN2A2_R72Q	6	EVRWFQSQF	A26:01	PMID:31844338	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPB41L3	EPB41L3_S495L	6	EVTPILAIR	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	ULK1	ULK1_T810A	6	FADPIAANL	A02:07	PMID:31844318	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ULK1	ULK1_T810A	6	FADPIAANL	C03:03	PMID:31844482	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ULK1	ULK1_T810A	6	FADPIAANL	C04:01	PMID:31844491	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ULK1	ULK1_T810A	6	FADPIAANL	C08:01	PMID:31844500	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ULK1	ULK1_T810A	6	FADPIAANL	C08:02	PMID:31844504	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	IRF2BPL	IRF2BPL_M413L	11	FAFDAVSKPGL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	MTFR2	MTFR2_D326Y	6	FAFQEYDSF	B35:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	NRP1	NRP1_V179A	2	FAPKMSEIIL	C03:04	PMID:31844489	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF213	RNF213_D2271V	10	FATPSLHTSV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_G113A	2	FAVTEYPTL	A02:07	PMID:31844319	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_G113A	2	FAVTEYPTL	A68:02	PMID:31844382	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_G113A	2	FAVTEYPTLKF	A02:07	PMID:31844324	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_G113A	2	FAVTEYPTLKF	A29:02	PMID:31844342	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_G113A	2	FAVTEYPTLKF	B35:01	PMID:31844416	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	WDR3	WDR3_Y588H	8	FFLSLHGHKL	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	NEK9	NEK9_D252H	2	FHATNPLNL	B38:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	7	FKLLSHSL	C07:02	PMID:31844497	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	A02:01	PMID:31844292	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	A02:03	PMID:31844303	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	A02:04	PMID:31844307	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	A02:07	PMID:31844320	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	A68:02	PMID:31844383	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	C03:02	PMID:31844477	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	C03:03	PMID:31844483	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	C03:04	PMID:31844487	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	C12:03	PMID:31844508	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVL	C17:01	PMID:31844525	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVLTSKY	A02:02	PMID:31844302	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVLTSKY	A02:03	PMID:31844306	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	4	FLANVSTVLTSKY	A29:02	PMID:31844343	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Skin	Melanoma	SNV	CCT4	CCT4_S115F	1	FLLDSCTKL	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	H2BC17	H2BC17_V67L	2	FLNDIFERI	A02:01	PMID:31844293	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	H2BC17	H2BC17_V67L	2	FLNDIFERI	A02:07	PMID:31844321	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	WDR3	WDR3_Y588H	7	FLSLHGHK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKLE2	ANKLE2_P266T	10	FPSPSKTSLTL	B07:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_A457P	2	FPVHGFPT	B54:01	PMID:31844463	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_A457P	2	FPVHGFPTL	A68:02	PMID:31844384	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_A457P	2	FPVHGFPTL	B54:01	PMID:31844464	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SLC22A15	SLC22A15_A396P	2	FPVVNSHSL	C03:04	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	FER	FER_C759F	8	FPYPGMTNQ	B51:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	ALB	ALB_L432I	6	FQNALIVRY	A29:02	PMID:31844340	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Colorectal	Colorectal Cancer	SNV	HNRNPC	HNRNPC_R122W	8	FQRDYYDW	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	DDX21	DDX21_S584F	1	FVPPTAISHF	B35:03	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OXSM	OXSM_K109T	4	FVSTSDIKSM	C03:04	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	FGA	FGA_A29T	5	GDFLTEGGGV	A32:01	PMID:31844351	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ZNF219	ZNF219_G602R	7	GEAGPGRAL	B40:01	PMID:31844427	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ABCC6	ABCC6_Q715E	2	GEELDPPWL	B18:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_A38V	3	GEVRPVETL	B40:02	PMID:31844430	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	NAPSA	NAPSA_L307R	6	GEYIIRCSEI	B49:01	PMID:31844449	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	MPDZ	MPDZ_I149V	4	GIAVSEEDTL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZNF416	ZNF416_Q49K	7	GLLDEAKRLLY	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HERC6	HERC6_R218L	2	GLNVPVQSNK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	DSTYK	DSTYK_V27A	8	GLRPTVDAL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH1	MROH1_L937I	6	GLSALILRY	A29:02	PMID:31844341	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-DQA2	HLA-DQA2_M230V	3	GLVGIVVGTV	A02:03	PMID:31844305	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SOHLH2	SOHLH2_L159M	9	GPEELGLPM	B35:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	FBRSL1	FBRSL1_P425W	11	GPSIHPGFLPW	B53:01	PMID:31844461	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CHI3L2	CHI3L2_L379F	5	GPYPFVQAV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SYTL4	SYTL4_S363F	6	GRIAFFLKY	B27:05	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	NUP43	NUP43_L331I	7	GRSSTFISH	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Skin	Melanoma	SNV	ABCC2	ABCC2_S1342F	9	GRTGAGKSFL	B27:05	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ABCC2	ABCC2_S1342F	9	GRTGAGKSFL	B27:05	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PSMD2	PSMD2_I896L	5	GRTPLMISK	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PLEKHF1	PLEKHF1_L37I	5	GRVLIGEGVLTK	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	AGBL3	AGBL3_P47L	5	GSLQLPPPR	A11:01	PMID:31844328	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	AGBL3	AGBL3_P47L	5	GSLQLPPPR	A11:02	PMID:31844331	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-DRA	HLA-DRA_L242V	9	GTIFIIKGVR	A66:01	PMID:31844376	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-DRA	HLA-DRA_L242V	9	GTIFIIKGVRK	A11:01	PMID:31844330	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-DRA	HLA-DRA_L242V	9	GTIFIIKGVRK	A11:02	PMID:31844333	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RTFDC1	RTFDC1_E177K	4	GTKKDVDVLK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	XIRP2	XIRP2_Q2514K	9	GTSAPRKKK	A11:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	PLXNB2	PLXNB2_A1554T	2	GTTLILSKV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_K145R	9	GVANALAHRY	A30:02	PMID:31844347	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	WDR1	WDR1_D26N	9	GVSKIIGGNPK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_G23A	3	HAAEYGAEAL	B35:03	PMID:31844417	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_G23A	3	HAAEYGAEAL	C03:03	PMID:31844486	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_G23A	3	HAAEYGAEAL	C08:01	PMID:31844502	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	GAPDH	GAPDH_N125H	3	HDHFGIVEGL	B54:01	PMID:31844466	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	UQCRB	UQCRB_D41H	1	HEDVKEAI	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	C9orf85	C9orf85_Q155R	4	HHARLIFVF	B38:02	PMID:31844425	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KLF5	KLF5_T163I	4	HIKIEPVAI	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	PKDREJ	PKDREJ_T1875I	2	HIYGSGGYAL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-F	HLA-F_I97V	3	HPVSDHEATL	B35:03	PMID:31844418	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-F	HLA-F_I97V	3	HPVSDHEATL	B53:01	PMID:31844459	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	GPAM	GPAM_H233Y	4	HRSYIDYLL	B27:05	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZNF84	ZNF84_T175A	9	HSKPEDTDAW	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HERC2	HERC2_A2060S	2	HSPFTATSL	C01:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TAF2	TAF2_D194H	1	HSYSELCTW	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	C1orf198	C1orf198_A14V	7	IAASRSVVM	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	MPDZ	MPDZ_I149V	3	IAVSEEDTL	B51:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CEP162	CEP162_E82D	4	IEEDSAEKI	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PBRM1	PBRM1_D578A	8	IEHNIRNAKY	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	NUP205	NUP205_L691V	5	IEVEVNEI	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	5	IFDLAGGTF	C02:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	5	IFDLAGGTFDV	C02:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	SCAF8	SCAF8_T183I	2	IINTDTLA	B50:01	PMID:31844450	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	CUX1	CUX1_I111K	2	IKREYEQTLK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SLC4A4	SLC4A4_A973V	8	ILKSTVAVI	B08:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	TEKT4	TEKT4_R100G	10	ILRDTSEDLGL	A02:02	PMID:31844299	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	C3	C3_H1312L	2	ILWESASLL	A02:04	PMID:31844308	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	IRS2	IRS2_S679I	8	IPASVSAPK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	ZNF267	ZNF267_C318Y	8	IPTEEKPYKW	B53:01	PMID:31844460	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ETAA1	ETAA1_E493Q	4	IQDQIQNCI	B38:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Colorectal Cancer	SNV	UNC13A	UNC13A_T650P	8	IQEIFAVPK	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	DENND4C	DENND4C_L1367Q	2	IQERLQKI	B37:01	PMID:31844422	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF213	RNF213_R2827L	9	ISTFRQCAL	C16:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	KMT2E	KMT2E_A445P	4	ITIPFDFDY	A01:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	RECQL	RECQL_H19R	6	ITSELRAVEI	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SART1	SART1_N554I	4	IVFIATSEF	B15:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CFAP70	CFAP70_E636G	6	IYTSSGQLQLF	A24:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	5	KFLANVSTV	C14:03	PMID:31844514	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_S132N	5	KFLANVSTVLTSKY	A30:02	PMID:31844348	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	ZBTB17	ZBTB17_Q400I	2	KIFTTSGNLK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	GLE1	GLE1_L220I	2	KIREAEQQRVK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	CENPE	CENPE_L1740I	2	KIRGIVSEK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	RAB3GAP1	RAB3GAP1_L367I	2	KITEPASVPIHK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC102724813	LOC102724813_D71E	8	KKFQSFQEH	B15:03	PMID:31844410	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Colorectal	Colorectal Cancer	SNV	RABL2A	RABL2A_I43L	2	KLDADINVT	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	Skin	Melanoma	SNV	TPD52L2	TPD52L2_S123L	2	KLFEDRVGTIK	A03:01	PMID:26819371	Use of HLA peptidomics and whole exome sequencing to identify human immunogenic neo-antigens	Oncotarget	2016	https://doi.org/10.18632/oncotarget.6960	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GLRX2	GLRX2_N94S	9	KLFHDMNVSY	A29:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NCAPG2	NCAPG2_P333L	2	KLILWRGLK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	EEF1A1	EEF1A1_E68Q	7	KLKAERQRGI	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	AKAP6	AKAP6_M1482I	6	KLKLPIIMK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	6	KLLSHSLLVTL	A02:01	PMID:31844296	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	6	KLLSHSLLVTL	A02:04	PMID:31844311	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	6	KLLSHSLLVTL	A02:11	PMID:31844326	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	SKP1	SKP1_R136H	7	KTPEEIHKTF	B57:03	PMID:31844471	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OR4P4	OR4P4_W300C		KVCCCQILL	A02:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	POLA1	POLA1_E1017K	1	KVFKLGNKV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	COL7A1	COL7A1_R468S	10	KVVLPSDVTSY	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_A136T	4	KVVTGVANA	A02:05	PMID:31844314	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	LSM7	LSM7_D20N	4	KYINKTIRV	A24:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	LSM7	LSM7_D20N	4	KYINKTIRVKF	A24:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ALB	ALB_K375E	3	LAETYETTLEK	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	2	LAGGTFDV	C02:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	OCA2	OCA2_L584A	2	LAGKVLAL	C03:03	PMID:31844481	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	OCA2	OCA2_L584A	2	LAGKVLAL	C16:01	PMID:31844518	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	ANKH	ANKH_I247A	2	LALATQRISRP	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LTF	LTF_R224M	3	LAMVPSHAV	B54:01	PMID:31844465	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LTF	LTF_R224M	3	LAMVPSHAVVA	B54:01	PMID:31844468	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PRKDC	PRKDC_M2085L	3	LELDELNRH	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ATP6V0A4	ATP6V0A4_P163H	7	LELKAVHAY	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GLRX2	GLRX2_N94S	8	LFHDMNVSY	A29:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	GPAM	GPAM_H233Y	9	LFLPVHRSYI	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RNF213	RNF213_R2827L	1	LFQQGKDLQQY	A29:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OR10J5	OR10J5_L32Q	6	LFVVFQTVY	A29:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SPEN	SPEN_P721L	1	LIERSQSPV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SPEN	SPEN_P721L	1	LIERSQSPVHL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	6	LIFDLAGGTF	C02:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	STK17B	STK17B_L143F	6	LIKQIFEGV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	GPAM	GPAM_H233Y	10	LLFLPVHRSY	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	TIFAB	TIFAB_D43E	7	LLGRGQEAHL	B13:01	PMID:31844403	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	5	LLSHSLLVTL	A02:01	PMID:31844294	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	5	LLSHSLLVTL	A02:02	PMID:31844298	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	5	LLSHSLLVTLA	A02:02	PMID:31844300	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	5	LLSHSLLVTLA	A02:05	PMID:31844316	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ZNF106	ZNF106_Y1024P	5	LLSYPRLL	B58:02	PMID:31844473	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	LRRC38	LRRC38_R182G	8	LPALRSLGL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	CTNS	CTNS_P80L	9	LPDEVVVPL	B51:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Skin	Melanoma	SNV	SEC23A	SEC23A_P52L	1	LPIQYEPV	B35:03	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo	1
tier3	NA	Skin	Melanoma	SNV	SEC23A	SEC23A_P52L	1	LPIQYEPVL	B35:03	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature communications	2016	https://doi.org/10.1038/ncomms13404	NeoPeptide	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SEC23A	SEC23A_P52L	1	LPIQYEPVL	B35:03	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	SBNO2	SBNO2_P694S	8	LPSDDRGSL	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	SMARCA2	SMARCA2_R357Q	8	LQARIAHQI	A02:03	PMID:31844304	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	DPY19L4	DPY19L4_K339N	7	LQLNVKNGSF	B37:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Colorectal	Colorectal Cancer	SNV	PLIN3	PLIN3_V263A	6	LQLSQALSL	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	ASB18	ASB18_C276T	4	LRLTALLLR	B15:17	PMID:31844411	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	MYPOP	MYPOP_L294P	4	LSAPLPLL	B52:01	PMID:31844455	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC105376722	LOC105376722_T67I	6	LSDPSIPGR	A34:01	PMID:31844364	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	B15:17	PMID:31844412	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C03:02	PMID:31844478	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C03:03	PMID:31844484	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C03:04	PMID:31844488	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C08:01	PMID:31844501	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C12:03	PMID:31844509	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	4	LSHSLLVTL	C15:02	PMID:31844515	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	FBXL3	FBXL3_I240V	3	LSVMEEVLI	C04:03	PMID:31844492	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	BICD2	BICD2_E489K	9	LTEKVSLLK	A01:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	A2M	A2M_L760I	7	LVEPEGIEK	C16:01	PMID:31844520	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PLEC	PLEC_P863L	7	LVGPAQLSHW	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12S	10	LVVVGASGVGK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	RTCB	RTCB_I348V	2	LVYDVSHNIAK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RFC3	RFC3_S44L	6	LVYGPLGAGK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NFE2L2	NFE2L2_D77Y	2	LYEETGEFL	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NFE2L2	NFE2L2_D77Y	2	LYEETGEFLPI	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	HAT1	HAT1_V308A	2	MAIEAQQKF	B35:07	PMID:31844419	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HAT1	HAT1_V308A	2	MAIEAQQKF	B53:01	PMID:31844458	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HAT1	HAT1_V308A	2	MAIEAQQKF	B58:01	PMID:31844472	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HAT1	HAT1_V308A	2	MAIEAQQKF	C12:02	PMID:31844505	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	INPP5B	INPP5B_Q606E	2	MELKVESF	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	INO80C	INO80C_P65S	6	MIVRPSQPR	A34:01	PMID:31844365	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	INO80C	INO80C_P65S	6	MIVRPSQPR	A66:01	PMID:31844374	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PTPN6	PTPN6_E471K	4	MLMKNISTK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZNF207	ZNF207_Q409L	5	MMPPLPGI	B51:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	WARS	WARS_D148H	2	MNQVLHAY	C07:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PDIA2	PDIA2_R209Q	10	MTFGLTDRPQL	A68:02	PMID:31844387	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	UTP18	UTP18_M547I	8	NEKGKALIY	C07:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KIF4A	KIF4A_L625V	9	NEQSKLLKV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	MAGI2	MAGI2_G76V	7	NETPVAVLTI	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_C105S	8	NFKLLSHSL	A24:07	PMID:31844336	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	YIPF2	YIPF2_P310L	9	NIALSPTLL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	PEX2	PEX2_C184R	3	NIREVGFEY	B15:02	PMID:31844407	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	STK38	STK38_W271L	9	NSKRKAETL	B08:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	STOM	STOM_K93N	8	NVDMRTISF	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	DPY19L4	DPY19L4_K339N	4	NVKNGSFVAK	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HSPA8	HSPA8_G201A	8	NVLIFDLA	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ZNF407	ZNF407_1779N	1	NYGTNVPVEF	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Colorectal	Colorectal Cancer	SNV	GLB1	GLB1_C390R	9	PLDTEDAVR	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	COL1A1	COL1A1_G194R	2	PRAPGPQGF	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	CACNA1H	CACNA1H_L1578A	8	PRGPAPAAL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	TTC9	TTC9_I256L	7	PTDTNVLRY	A01:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-B	HLA-B_E100V	7	QAQTDRVSL	B42:01	PMID:31844438	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-B	HLA-B_E100V	7	QAQTDRVSL	C16:01	PMID:31844521	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OSBP2	OSBP2_Y677H	7	QASGNHHVW	B44:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	DHX58	DHX58_M513L	9	QAVAAVQKL	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKRD20A4	ANKRD20A4_M646R	9	QDVSVQVER	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GMPPA	GMPPA_G92V	9	QEFAPLGTV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GMPPA	GMPPA_G92V	9	QEFAPLGTVG	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PI3	PI3_K66L	5	QEPVLGPV	A02:01	PMID:31844290	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PI3	PI3_K66L	5	QEPVLGPV	A02:05	PMID:31844312	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PI3	PI3_K66L	5	QEPVLGPV	A68:02	PMID:31844380	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZZEF1	ZZEF1_G863V	10	QEVRNTLLNV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	STK17B	STK17B_L143F	3	QIFEGVYYL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	ZNF267	ZNF267_C318Y	10	QIIPTEEKPYK	A30:01	PMID:31844345	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	DPY19L4	DPY19L4_K339N	6	QLNVKNGSFV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	MROH6	MROH6_D688L	6	QLPEPLPGL	A02:07	PMID:31844322	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NFE2L2	NFE2L2_D77Y	3	QLYEETGEF	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	STXBP1	STXBP1_R171L	9	QMKNPILEL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ATF7IP	ATF7IP_G1021L	9	QPSGVPTSL	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	RBAK-RBAKDN	RBAK-RBAKDN_T32A	10	QQLDPDEKIAY	B15:01	PMID:31844406	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	CTNNB1	CTNNB1_S37Y	10	QSYLDSGIHY	A01:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RSBN1L	RSBN1L_T584A	3	QTAAAVGVLK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Hct 116 Cell Line	SNV	CHMP7	CHMP7_A324T	9	QTDQMVFNTY	A01:01	PMID:25576301	Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation	Molecular & Cellular Proteomics	2015	https://doi.org/10.1074/mcp.m114.042812	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	BIRC6	BIRC6_G2619fs	6	QTKPASLLY	A26:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	WASHC1	WASHC1_F33L	7	QTYAVPLI	B52:01	PMID:31844456	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	CIART	CIART_R6V	2	QVIVGVLQK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CDK1	CDK1_S107I	10	QYMDSSLVKI	A23:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	MKLN1	MKLN1_D521V	5	RATIVPEL	C03:04	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	RECQL	RECQL_H19R	1	RAVEIQIQEL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SPEN	SPEN_P721L	9	RDRDHERRL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	TEKT4	TEKT4_A143V	11	REITDQEHNVVA	B40:06	PMID:31844436	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ALB	ALB_N42H	9	RFKDLGEEHF	A23:01	PMID:31844335	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Skin	Melanoma	SNV	H3F3C	H3F3C_T4I	2	RIKQTARK	A03:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	H3F3C	H3F3C_T4I	2	RIKQTARK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	NOL10	NOL10_L505I	2	RILNPLVSK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	HAX1	HAX1_L71I	2	RIREGQTLR	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	BST2	BST2_L137I	2	RIRRENQVL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ALB	ALB_K375E	4	RLAETYETTL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SLC38A10	SLC38A10_G122R	9	RLFGFQVGR	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Skin	Melanoma	SNV	RBPMS	RBPMS_P46L	2	RLFKGYEGSLIK	A03:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	RBPMS	RBPMS_P46L	2	RLFKGYEGSLIK	A03:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SPEN	SPEN_P721L	2	RLIERSQSPV	B37:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	STK17B	STK17B_L143F	7	RLIKQIFEGV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PSMC4	PSMC4_I344L;I348L	3,7	RLLFSTLTSK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_C113V	9	RLLGNVLVVV	A02:01	PMID:31844295	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LACTB	LACTB_M5L	3	RLLSAVTAR	A74:01	PMID:31844392	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	XRCC2	XRCC2_I95V	5	RLVTVLEHRL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	EMC10	EMC10_A243R	3	RPRAPGPAP	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_A97T	5	RQAQTDRVSL	B13:01	PMID:31844404	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	EEF2KMT	EEF2KMT_T25A	8	RRFLAARAL	B27:05	PMID:31844415	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	TNPO3	TNPO3_I169L;I170L	5,6	RRTELLEDL	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OR2A2	OR2A2_C317F	10	RSMRTVYGLF	A24:02	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKRD20A4	ANKRD20A4_M646R	3	RTQDVSVQVER	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	PTPRM	PTPRM_Q718R	1	RVATKGAATPK	A11:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	PPFIBP1	PPFIBP1_H427Q	8	RVDGRMLQY	A36:01	PMID:31844370	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	PLEKHF1	PLEKHF1_L37I	4	RVLIGEGVLTK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	AGT	AGT_I29V	4	RVYVHPFHL	C07:01	PMID:31844496	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	DYNC1H1	DYNC1H1_Y2496R	5	RYLVRAIL	C14:03	PMID:31844512	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PARP14	PARP14_P1095A	9	RYVLHVVAA	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A25:01	PMID:31844337	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A26:01	PMID:31844339	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A32:01	PMID:31844353	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A33:01	PMID:31844356	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A33:03	PMID:31844360	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A34:01	PMID:31844366	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A34:02	PMID:31844369	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A66:01	PMID:31844378	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	7	SAQGSDMSLTACKV	A74:01	PMID:31844394	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	C15orf40	C15orf40_T152I	5	SARIIGVSH	C12:02	PMID:31844506	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KIF3C	KIF3C_R785H	5	SASLHPATV	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	INTS2	INTS2_N760H	7	SAVPVNHTQVM	C08:01	PMID:31844503	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-C	HLA-C_T363A	7	SDESLIACKA	C12:03	PMID:31844511	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	3	SDMSLTACKV	A66:01	PMID:31844377	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-A	HLA-A_V355M	3	SDMSLTACKV	A74:01	PMID:31844393	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	C3	C3_G1329R	9	SEETKENERFTV	A32:01	PMID:31844352	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ANKRD20A1	ANKRD20A1_R39K	8	SELQKIHKA	B40:02	PMID:31844431	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ANKRD20A1	ANKRD20A1_R39K	8	SELQKIHKA	B40:06	PMID:31844434	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ANKRD20A1	ANKRD20A1_R39K	8	SELQKIHKA	B45:01	PMID:31844443	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_A83E	2	SELSDLHAH	B18:01	PMID:31844414	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBA2	HBA2_A83E	2	SELSDLHAHKL	B40:02	PMID:31844433	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ZNF571	ZNF571_L575V	2	SELTVHQRI	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	CTSC	CTSC_I153T	8	SENVYVNTA	B40:06	PMID:31844435	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CTSC	CTSC_I153T	8	SENVYVNTA	B45:01	PMID:31844444	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	KRT10	KRT10_I101S	9	SFGGSYGGSF	A36:01	PMID:31844371	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	KRT10	KRT10_I101S	9	SFGGSYGGSF	A68:02	PMID:31844386	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	BLMH	BLMH_F324V	10	SIKDGEAVWV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	RECQL	RECQL_H19R	7	SITSELRAV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	REXO4	REXO4_S129P	7	SMAARVPI	C16:01	PMID:31844519	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HLA-B	HLA-B_S35A	8	SMRYFYTAV	C15:02	PMID:31844516	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC112268168	LOC112268168_S14L	4	SPALASRVA	B55:01	PMID:31844469	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	HERC2	HERC2_A2060S	7	SPFTATSL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NOP16	NOP16_P169L	9	SPGPVKLEL	B07:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	B721.221 Cell Line	SNV	SPIB	SPIB_L84P	2	SPHTPRRTSL	B07:04	PMID:31844400	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	COQ4	COQ4_G50A	6	SPLQKALLA	B55:02	PMID:31844470	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKLE2	ANKLE2_P266T	8	SPSKTSLTL	B07:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	IQGAP1	IQGAP1_A332V	3	SPVLGLRGL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	RGS10	RGS10_L137I	8	SRFLKSDIF	C07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ATR	ATR_E183K	9	SRFLSQLDK	B27:05	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	INPPL1	INPPL1_L653I	8	SRKEFEPIL	C07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RANBP9	RANBP9_H135L	9	SSAAAPFPL	C03:04	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PIK3AP1	PIK3AP1_R733W	10	SSTSNRSSTW	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	CLCN6	CLCN6_E176G	9	SVAGGLFVGK	A11:01	PMID:31844329	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	CLCN6	CLCN6_E176G	9	SVAGGLFVGK	A11:02	PMID:31844332	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SLFN11	SLFN11_R124H	5	SVKPHLCSL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	UBASH3B	UBASH3B_G307V	2	SVLLPENYITK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	PZP	PZP_G66V	2	SVRENRSLF	A66:01	PMID:31844375	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPS8	EPS8_Q64E	7	SVSDISEYR	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPS8	EPS8_Q64E	7	SVSDISEYRV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	DOCK10	DOCK10_R1149L	8	SVTNEFCLK	A11:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	GPAM	GPAM_H233Y	2	SYIDYLLLTF	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	SAMD9	SAMD9_M213I	7	TEEDVKIKF	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	CEL	CEL_G41S	14	TEGGFVEGVNKKLSL	A68:02	PMID:31844391	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	C10orf67	C10orf67_N204E	2	TEILLRKL	B18:01	PMID:31844413	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	C10orf67	C10orf67_N204E	2	TEILLRKL	B40:02	PMID:31844428	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	NUP205	NUP205_E998Q	5	TEQKQTSVL	B40:02	PMID:31844432	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	TNS3	TNS3_I17V	5	TERIVAVSF	B18:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12V	11	TEYKLVVVGAV	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	NCOR1	NCOR1_R33H	2	THHQQDPAF	B38:02	PMID:31844426	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	AHSG	AHSG_E65S	7	TLNQIDSVKV	A02:04	PMID:31844310	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ATP4A	ATP4A_P796V	7	TLTKNIVEL	A02:04	PMID:31844309	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PPIP5K2	PPIP5K2_P1074L	3	TPLATLKST	A34:02	PMID:31844368	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	AP3B1	AP3B1_S817T	8	TPLTKDVTL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	STARD5	STARD5_M108V	6	TPSAAVKLI	B51:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	RPS4X	RPS4X_L222I	3	TRISNIFVI	C07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ALB	ALB_K437R	2	TRKVPQVSTPTL	A02:07	PMID:31844325	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ALB	ALB_K437R	2	TRKVPQVSTPTL	A68:02	PMID:31844389	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	ALB	ALB_K437R	2	TRKVPQVSTPTL	B51:01	PMID:31844453	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	WDR19	WDR19_A282V	4	TSIVVSQTL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SLC4A4	SLC4A4_A973V	4	TVAVIIFPV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	TNS3	TNS3_I17V	8	TYITERIVAV	A24:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CAPG	CAPG_E314K	3	VAKGFISRM	C12:03	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	SLC10A2	SLC10A2_S171A	2	VALVVPVSI	B51:01	PMID:31844452	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_K145R	8	VANALAHRY	A30:02	PMID:31844346	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	HBB	HBB_K145R	8	VANALAHRY	C02:02	PMID:31844476	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	NOP56	NOP56_M167I	4	VDNIIIQSI	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	STX5	STX5_E134Q	5	VEIEQLTY	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	DDX60L	DDX60L_A631S	8	VEMLGLISC	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CAPRIN2	CAPRIN2_S554N	3	VENQKHSL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CFL2	CFL2_D49Y	3	VEYPYTSF	B18:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ATP6AP2	ATP6AP2_E145K	3	VFKDLSVTL	B38:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12D	4	VGADGVGKSAL	C01:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	FAM170A	FAM170A_E56K	9	VGEVTSTSKYC	C04:03	PMID:31844493	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12V	1	VGVGKSAL	C17:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	RTFDC1	RTFDC1_E177K	9	VIMLNGTKK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	DPY19L4	DPY19L4_K339N	3	VKNGSFVAKI	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	SNV	ENTPD1	ENTPD1_L62I	11	VLDAGSSHTSIY	A01:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	ALB	ALB_K375E	8	VLLLRLAET	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	HADHA	HADHA_G341V	1	VLYHGQVL	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Colorectal	Colorectal Cancer	SNV	GSTP1	GSTP1_G208V	9	VNLPINGNVKQ	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	PHF3	PHF3_N447K	5	VPDQKSKQL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	OR4C12	OR4C12_M279I	3	VPILNPVVY	B35:07	PMID:31844420	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	COL9A3	COL9A3_G29P	2	VPLPGPPGPPG	B53:01	PMID:31844462	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	WIZ	WIZ_R703F	4	VPPFLQPE	A02:01	PMID:31844291	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	WIZ	WIZ_R703F	4	VPPFLQPE	A02:05	PMID:31844313	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	WIZ	WIZ_R703F	4	VPPFLQPE	A68:02	PMID:31844381	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	INTS2	INTS2_N760H	5	VPVNHTQVM	B35:07	PMID:31844421	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	INTS2	INTS2_N760H	5	VPVNHTQVM	B42:01	PMID:31844439	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	PMAIP1	PMAIP1_G72L	5	VQVALSRV	B52:01	PMID:31844457	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	WDR1	WDR1_D26N	8	VSKIIGGNPK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	IRF2BPL	IRF2BPL_M413L	6	VSKPGLDYEL	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	CTNNAL1	CTNNAL1_E323D	4	VTLDVILER	B57:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	OSBPL11	OSBPL11_G489W	9	VTNHAPLSW	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12C	5	VVGACGVGK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	COL7A1	COL7A1_R468S	9	VVLPSDVTSY	A32:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TBCK	TBCK_D478H	6	VVSHPHLVYW	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRAS	KRAS_G12C	6	VVVGACGVGK	A03:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	CTSC	CTSC_I153T	5	VYVNTAHL	C14:03	PMID:31844513	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SLC4A4	SLC4A4_A973V	9	WILKSTVAV	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	SLC4A4	SLC4A4_A973V	9	WILKSTVAVI	A02:01	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TBCK	TBCK_D478H	1	WVVSHPHLV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987441	LOC107987441_L220F	7	YAQLHSFTL	C03:02	PMID:31844479	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987441	LOC107987441_L220F	7	YAQLHSFTL	C03:03	PMID:31844485	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987441	LOC107987441_L220F	7	YAQLHSFTL	C12:03	PMID:31844510	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	B cell	B721.221 Cell Line	SNV	LOC107987441	LOC107987441_L220F	7	YAQLHSFTL	C16:01	PMID:31844522	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Colorectal	Colorectal Cancer	SNV	GAA	GAA_V780I	8	YDLQTVPIE	NA	PMID:30192525	Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides	Analytical Chemistry	2018	https://doi.org/10.1021/acs.analchem.8b02420	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	TDG	TDG_G343V	6	YEAAYVGAY	B44:02	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Liver	Hepatocellular Carcinoma	SNV	NFE2L2	NFE2L2_D77Y	1	YEETGEFLPI	B18	PMID:31039795	Multi-omics discovery of exome-derived neoantigens in hepatocellular carcinoma	Genome Medicine	2019	https://doi.org/10.1186/s13073-019-0636-8	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	UQCRB	UQCRB_D41H	3	YEHEDVKEA	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	UQCRB	UQCRB_D41H	3	YEHEDVKEAI	B49:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	C1S	C1S_P295L	9	YHGDPMPCL	B38:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Skin	Melanoma	SNV	44806	SEPT2_Q125R	5	YIDERFERY	A01:01	PMID:27869121	Direct identification of clinically relevant neoepitopes presented on native human Melanoma tissue by mass spectrometry	Nature Communications 	2016	https://doi.org/10.1038/ncomms13404	dbPepNeo,NeoPeptide	2
tier3	KADA	Skin	Melanoma	SNV	ENC1	ENC1_P230S	3	YLSELLQTV	A02:01	PMID:31921104	Cancer Neoepitopes for Immunotherapy: Discordance Between Tumor-Infiltrating T Cell Reactivity and Tumor MHC Peptidome Display	Frontiers in Immunology	2019	https://doi.org/10.3389/fimmu.2019.02766	dbPepNeo	1
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	GABRB3	GABRB3_T185N	2	YNTDDIEFY	A29:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TOX2	TOX2_S382Y	1	YPAPQPPVL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Colorectal	Hct 116 Cell Line	SNV	NR1D1	NR1D1_G39D	7	YSDNSNDSF	A01:01	PMID:25576301	Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation	Molecular & Cellular Proteomics	2015	https://doi.org/10.1074/mcp.m114.042812	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	KRTAP20-2	KRTAP20-2_G9C	6	YSNYYCGLRY	B15:01	PMID:28832583	Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity	PLoS Computational Biology	2017	https://doi.org/10.1371/journal.pcbi.1005725	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	ANKRD52	ANKRD52_A559S	9	YTAVHYAASY	A01:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPHB2	EPHB2_A410G	7	YTFEIQGV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	EPHB2	EPHB2_A410G	7	YTFEIQGVNGV	A68:02	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TNFAIP1	TNFAIP1_R48L	9	YTTVRALTL	B08:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	CEL	CEL_T471L	11	YVFGKPFATPLGY	A29:02	PMID:31844344	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	LRPPRC	LRPPRC_T1335I	8	YVSEKDVISAK	A68:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	Lung	Non-Small Cell Lung Cancer	SNV	TSR1	TSR1_H561Y	1	YVSEVPVSV	C17:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	B721.221 Cell Line	SNV	HEPH	HEPH_I622T	8	YYSAVDPTK	A23:01	PMID:31844334	A large peptidome dataset improves HLA class I epitope prediction across most of the human population	Nature Biotechnology	2020	https://doi.org/10.1038/s41587-019-0322-9	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	EVYAAGKYV	A26:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	YAAGKYVSF	A26:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	YAAGKYVSF	B14:02	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	YAAGKYVSF	C08:02	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	EVYAAGKYV	C12:03	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	KCNAB2	NA	NA	YAAGKYVSF	C12:03	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	SMARCD1	NA	NA	LAMSDVSHPK	A11:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	Skin	Melanoma	RNA splicing	SMARCD1	NA	NA	AMSDVSHPK	A11:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	B cell lymphoma	RNA splicing	LRSAM1	NA	NA	FRYVAQAGL	B27:04	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	B cell lymphoma	RNA splicing	LRSAM1	NA	NA	FRYVAQAGL	C12:02	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	B cell lymphoma	RNA splicing	CYB561A3	NA	NA	TLFLLSLPL	B08:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	B cell lymphoma	RNA splicing	CYB561A3	NA	NA	FLLSLPLPV	B08:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	B cell lymphoma	RNA splicing	CYB561A3	NA	NA	FLLSLPLPV	C07:04	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	Leukemia	RNA splicing	BCYRN1	NA	NA	SVLDDVRGW	B57:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	Leukemia	RNA splicing	ZCCHC6	NA	NA	LTSQGKSAF	B15:11	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	Leukemia	RNA splicing	ZCCHC6	NA	NA	LTSQGKSAF	B35:01	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	Leukemia	RNA splicing	ZCCHC6	NA	NA	LTSQGKSAF	C03:03	PMID:30114007	Intron retention is a source of neoepitopes in cancer	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4239	NA	0
tier3	NA	B cell	Leukemia	Non-coding	ATG5	NA	NA	HETLRLLL	B40:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	ZNF219	NA	NA	IIAPPPPPK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	C5orf56	NA	NA	KILILLQSL	A02:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	NA	NA	NA	KISLYLPAL	A02:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	NA	NA	NA	KPSVFPLSL	B07:02	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	WIPF1	NA	NA	LLAATILLSV	A02:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	KCNK12	NA	NA	LPFEQKSL	B08:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	NA	NA	NA	LVFNIILHR	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	CEACAM6	NA	NA	MISPVLALK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	NA	NA	NA	QRFQGRVTM	C07:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	LINC01781	NA	NA	RIFGFRLWK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	RFWD2	NA	NA	SLREKGFSI	B08:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	PIH1D3	NA	NA	SLSYLILKK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	TCL1A	NA	NA	SLTALVFHV	A02:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	NA	NA	NA	SRFSGVPDRF	A24:02	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	TMC5	NA	NA	SSASQLPSK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	LRRC31	NA	NA	SVIQTGHLAK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	POLR2J4	NA	NA	TSFAETWMK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	NA	NA	NA	TSIPKPNLK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	MECOM	NA	NA	TTLKYLWKK	A11:01	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	Lung	Lung Cancer	Non-coding	CALCA	NA	NA	TYTQNFNKF	A24:02	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Leukemia	Non-coding	PIK3CG	NA	NA	VPAALRSL	B07:02	PMID:30518613	Noncoding regions are the main source of targetable tumor-specific antigens	Science Translational Medicine	2018	https://doi.org/10.1126/scitranslmed.aau5516	dbPepNeo	1
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	DOT1L	DOT1L_H457del	NA	HSPSPFYQL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	SPATS2	SPATS2_SQQPR199_203del	NA	IHNNAAKSL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	TWF1	TWF1_N266delinsGG	NA	KLGGNRQLNY	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	AHCTF1	AHCTF1_L1208del	NA	LHLETPLVVK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	INDEL	CEP128	CEP128_R102fs	NA	LRNSGGEVF	B27:05	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	VDAC3	LDTI100_103del	NA	LTFVPNTGK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	GNL2	GNL2_637_638insK	NA	PEKEQRKTL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	CCND3	CCND3_15_16insA	NA	PRAAGPDPRL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	UBA3	UBA3_P246del	NA	PRLEHCIEY	C02:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	USP10	USP10_174_175insL	NA	PRTPLSYSI	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	FBN1	FBN1_560_561insV	NA	PRVPPVEYL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	TRAPPC13	TRAPPC13_Y251del	NA	QPMDTRQLY	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	C2CD3	C2CD3_R278del	NA	RAPKQMSLL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	TCF25	TCF25_R558del	NA	RAPNIHRHVIL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	MEAF6	MEAF6_R178del	NA	RHIDLKLNK	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	CCNL1	CCNL1_R147del	NA	RRIDVINVF	C02:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	PRRC2C	PRRC2C_R796del	NA	RSADHAISL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	DDX3X	KSR589_591del	NA	RSFSGGFGA	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	BRK1	BRK1_R46del	NA	RSLATLNEK	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	CHCHD2	RTSR8_11del	NA	RSMAPPASR	B27:05	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	C2CD3	C2CD3_R1186del	NA	RSPTAEGVL	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	SPEN	KLLE1864_1867del	NA	SPRGEAQLK	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	DDX3X	TR213_214del	NA	TRYPTPVQK	A03:01	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	B cell	Gr Lymphoblastoid Cell Line	INDEL	PDE12	PDE12_S50del	NA	VPSEPKLLS	B07:02	PMID:32561536	Identification of the cryptic HLA-I immunopeptidome 	Cancer Immunology Research	2020	https://cancerimmunolres.aacrjournals.org/content/8/8/1018	NA	0
tier3	NA	Lung	Non-Small Cell Lung Cancer	INDEL	ZMAT3	ZMAT3_V240fs	NA	WPVLLLNV	B51:01	PMID:30556813	Deep learning using tumor HLA peptide mass spectrometry datasets improves neoantigen identification	Nature Biotechnology	2018	https://doi.org/10.1038/nbt.4313	NeoPeptide,dbPepNeo	2
